Protein Info for DDA3937_RS09000 in Dickeya dadantii 3937

Annotation: SDR family oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 transmembrane" amino acids 116 to 134 (19 residues), see Phobius details PF00106: adh_short" amino acids 7 to 189 (183 residues), 153.5 bits, see alignment E=7.6e-49 PF08659: KR" amino acids 10 to 157 (148 residues), 45.4 bits, see alignment E=1.3e-15 PF13561: adh_short_C2" amino acids 16 to 247 (232 residues), 195.7 bits, see alignment E=1.4e-61

Best Hits

KEGG orthology group: None (inferred from 99% identity to dze:Dd1591_2450)

Predicted SEED Role

"Enoyl-[acyl-carrier-protein] reductase [NADPH] (EC 1.3.1.10)" in subsystem Fatty Acid Biosynthesis FASII (EC 1.3.1.10)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SL75 at UniProt or InterPro

Protein Sequence (248 amino acids)

>DDA3937_RS09000 SDR family oxidoreductase (Dickeya dadantii 3937)
MSRLQGKRALITGGTSGIGLETAKLFVAEGARVIVTGVNPDSIAKAKVELGNDVLVVSAD
SADVNAQKALAQTVKEHFGELDIAFLNAGISMYMPIEVWTEEMFDRIYDINVKGPYFLMQ
ALLPVFASSASVVFNTSINAHTGPENSSVYGSTKAALLNMSKTLSNELLSRGIRINAVSP
GPVDTPLYDKAGIPIEYHDQVMKDIVATIPAGRFGKPQEVAQAVLYFASDESAWTVGSEI
IIDGGVSI