Protein Info for DDA3937_RS08975 in Dickeya dadantii 3937

Annotation: DUF1304 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 116 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 47 to 67 (21 residues), see Phobius details amino acids 73 to 92 (20 residues), see Phobius details amino acids 98 to 115 (18 residues), see Phobius details PF06993: DUF1304" amino acids 9 to 113 (105 residues), 142.7 bits, see alignment E=2.1e-46

Best Hits

KEGG orthology group: K08987, putative membrane protein (inferred from 92% identity to dze:Dd1591_2464)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (116 amino acids)

>DDA3937_RS08975 DUF1304 domain-containing protein (Dickeya dadantii 3937)
MLANILVAVIAVIHLYILVLEMFLWDTEIGRKAFNLHADFARSTRTLAANQGLYNGFLAA
GLLWGLWLGESGIQVTVFFLVCVLIAGIFGAVTASRKILYVQAIPASAALIALFFR