Protein Info for DDA3937_RS08770 in Dickeya dadantii 3937

Annotation: tetratricopeptide repeat protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 388 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF13414: TPR_11" amino acids 279 to 315 (37 residues), 32.9 bits, see alignment 1.4e-11 PF13181: TPR_8" amino acids 303 to 331 (29 residues), 13.4 bits, see alignment (E = 2.7e-05) amino acids 342 to 368 (27 residues), 13.5 bits, see alignment (E = 2.4e-05) PF13424: TPR_12" amino acids 303 to 368 (66 residues), 30.6 bits, see alignment E=1.1e-10 PF13176: TPR_7" amino acids 344 to 370 (27 residues), 17.4 bits, see alignment (E = 1.3e-06)

Best Hits

KEGG orthology group: None (inferred from 100% identity to ddd:Dda3937_02893)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SL26 at UniProt or InterPro

Protein Sequence (388 amino acids)

>DDA3937_RS08770 tetratricopeptide repeat protein (Dickeya dadantii 3937)
MNKKIMALGALLFLSQASAAPVSIEVLDATIKDKKIAEADVMLQRDGAQTAVGRTNALGQ
VQLSPTFAADENALLIIKKPGFSNLVVKCPCDGLTYAISPVMKNLDGMRIVLTWGATPAD
LDSHLVYGNSHIYFDNQKGPDANLDVDDVDSYGPETITIEKKRFGESYLYAVHDYTHIHE
PDQAALSNSQAKVFVYVGQSLVRTYSVPRNQVGNLWTVFRLNPNGDFEDINTIKQTGYQD
PNNVAAGVSGQLSGRAATGVVNVNQAAAKALNRQGEDAYRRGDLESAIAFYQQAIEQDAV
FSQAYSNLGLAYQKLDRIAEAIWANRKAIALADGPNAATVRASSYYNIARIYEAAGQLDD
ALRHYQLAKAQKDSATYDQAISRIKSKL