Protein Info for DDA3937_RS08595 in Dickeya dadantii 3937

Annotation: iron ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 530 transmembrane" amino acids 30 to 53 (24 residues), see Phobius details amino acids 74 to 98 (25 residues), see Phobius details amino acids 110 to 130 (21 residues), see Phobius details amino acids 140 to 162 (23 residues), see Phobius details amino acids 194 to 216 (23 residues), see Phobius details amino acids 237 to 258 (22 residues), see Phobius details amino acids 286 to 314 (29 residues), see Phobius details amino acids 334 to 356 (23 residues), see Phobius details amino acids 368 to 390 (23 residues), see Phobius details amino acids 396 to 417 (22 residues), see Phobius details amino acids 452 to 477 (26 residues), see Phobius details amino acids 499 to 521 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 101 to 261 (161 residues), 41 bits, see alignment E=8.9e-15 amino acids 355 to 527 (173 residues), 83.6 bits, see alignment E=7.8e-28

Best Hits

Swiss-Prot: 83% identical to FBPB_SERMA: Fe(3+)-transport system permease protein SfuB (fbpB) from Serratia marcescens

KEGG orthology group: K02011, iron(III) transport system permease protein (inferred from 100% identity to ddd:Dda3937_03767)

Predicted SEED Role

"Ferric iron ABC transporter, permease protein" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SKB1 at UniProt or InterPro

Protein Sequence (530 amino acids)

>DDA3937_RS08595 iron ABC transporter permease (Dickeya dadantii 3937)
MADVEWKVAGVGVTPPARPGARPYRIAGGGMALVALLLSLLALLPLGFVVGITLETDWDT
IKALVFRPRVGELLLNTVLLVAVTLPLCTLLGVALAWLTERTTLPGRRAWSLLLTAPLAV
PTFVQSYAWISLLPGMHGPAAGVFLSVLAYFPFIYLPAAAVLRRLDPSLEDVATSLGARP
WRVFFRVVLPQLRLAVWGGSLLIALHLLAEYGLYAMIRFDTFTTAIFEQFQSTFNGLAAN
MLAGVLVLCCLGLLLLEALTRGRARYARVGSGSARSQTPWRLSSPAALVCALLPLALTVL
ALGVPLMTLARWLWLGGLDVWRNNELWPALRQTLWLGVSGAALVTLCAFPMSWLSVRHPS
RLYRLLEGCNYITSALPGIVVALALVTVTIHTLRPLYQTEFTLLLAYVLMFMPRALINLR
AGIAQAPVELENVARSLGCSPGQALWRITLRLAAPGAAAGAAMVFLAVTNELTATLLLAP
NGTRTLATGFWALTSEIDYMAAAPYALIMVVLSLPLTWLLYSQSKRTAGL