Protein Info for DDA3937_RS08540 in Dickeya dadantii 3937

Annotation: uridine diphosphate-N-acetylglucosamine-binding protein YvcK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 PF01933: CofD" amino acids 12 to 286 (275 residues), 253.5 bits, see alignment E=1.2e-79 TIGR01826: conserved hypothetical protein" amino acids 12 to 265 (254 residues), 299.6 bits, see alignment E=1.5e-93

Best Hits

Swiss-Prot: 74% identical to GNGF_YERPE: Putative gluconeogenesis factor (YPO1158) from Yersinia pestis

KEGG orthology group: None (inferred from 100% identity to ddd:Dda3937_03755)

Predicted SEED Role

"FIG002813: LPPG:FO 2-phospho-L-lactate transferase like, CofD-like"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SK98 at UniProt or InterPro

Protein Sequence (306 amino acids)

>DDA3937_RS08540 uridine diphosphate-N-acetylglucosamine-binding protein YvcK (Dickeya dadantii 3937)
MGNRTLAELDRVVALGGGHGLGRVMSSLSFLGSRLTGIVTTTDNGGSTGRIRRSEGGIAW
GDTRNCLNQLITAPSVASAMFEYRFSGNGELSGHNLGNLMLKAMDHLSVRPLEAINLIRN
LLKVDALLIPMSEQPVDLLAIDTLGNPVYGEVAVDQLATLPQDLMLYPAAPATQEALTAI
AEADLILIGPGSFLTSLMPPLLLADLAQSLHDARAPVVYIGNLGDEQSQIATRLTLAQKL
QLIESKIDRRIIDAVVVAPRTDTRGVDDRLIIQQPLGAQDVPHHHDRVLLRAALEQAAQS
LGLCPV