Protein Info for DDA3937_RS08320 in Dickeya dadantii 3937

Annotation: type 1 glutamine amidotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00117: GATase
  • amino acids 29 to 185 (157 residues), 58.2 bits, E=4.7e-20

Best Hits

Swiss-Prot: 56% identical to YFEJ_SALTY: Putative glutamine amidotransferase-like protein YfeJ (yfeJ) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K01951, GMP synthase (glutamine-hydrolysing) [EC: 6.3.5.2] (inferred from 100% identity to ddd:Dda3937_03588)

MetaCyc: 56% identical to gamma-L-glutamyl hydroxamate hydrolase (Salmonella enterica enterica serovar Typhimurium str. LT2)
RXN1R65-43

Predicted SEED Role

"putative glutamine amidotransferase class-I"

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (46/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (26/26 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotide salvage (13/14 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis II (8/8 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis I (6/6 steps found)
• guanosine ribonucleotides de novo biosynthesis (4/4 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (3/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (3/4 steps found)
• L-glutamate and L-glutamine biosynthesis (5/7 steps found)
• L-citrulline biosynthesis (5/8 steps found)
• superpathway of L-citrulline metabolism (7/12 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Drug metabolism - other enzymes
• Glutamate metabolism
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 6.3.5.2

Use Curated BLAST to search for 6.3.5.2

Sequence Analysis Tools

See E0SJF9 at UniProt or InterPro

Protein Sequence (241 amino acids)

>DDA3937_RS08320 type 1 glutamine amidotransferase (Dickeya dadantii 3937)
MRVHFIVHEHFEAPGVFETWAMIRDHEVTFSRVYAGQKLPEDARNIDLLVVMGGPQDPSV
TPDECAHFDSRAEQALIASAVHLGKAVIGVCLGAQLIGEALGARFAHSPEKEIGKFPVFM
TAESERNPLFSHFGNKLDVGHWHNDMPGLTPAAEIVAYSEGCPRQIVAYSELVYGFQCHM
ELTPSLVELLIAHSDRDLRRAAEYRFVQTPEELRSHDYSEMNRALFTFLDKLESRYRQTG
I