Protein Info for DDA3937_RS08085 in Dickeya dadantii 3937

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 transmembrane" amino acids 16 to 36 (21 residues), see Phobius details amino acids 42 to 61 (20 residues), see Phobius details amino acids 81 to 97 (17 residues), see Phobius details amino acids 103 to 123 (21 residues), see Phobius details amino acids 136 to 158 (23 residues), see Phobius details amino acids 164 to 187 (24 residues), see Phobius details amino acids 216 to 237 (22 residues), see Phobius details amino acids 243 to 266 (24 residues), see Phobius details amino acids 277 to 296 (20 residues), see Phobius details amino acids 302 to 323 (22 residues), see Phobius details amino acids 335 to 357 (23 residues), see Phobius details amino acids 373 to 395 (23 residues), see Phobius details PF07690: MFS_1" amino acids 18 to 265 (248 residues), 82.1 bits, see alignment E=1.9e-27

Best Hits

KEGG orthology group: None (inferred from 100% identity to ddd:Dda3937_02987)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SJA7 at UniProt or InterPro

Protein Sequence (403 amino acids)

>DDA3937_RS08085 MFS transporter (Dickeya dadantii 3937)
MKFLFTKDVLLHNKSWFLLSGTFLSVLSSFFIIPYYVVYLYQSLGMSVFQVSLLLMLRAT
LEKGLTLPAGMMADNIGAKKVALLGIALRIIGLILLADAHTFAGLVASSLLNGVGLACGM
IASKKAMLELIDSNMKAFASIGLAINMGVAVGPLVGYLMIGYDFAFLCYTNAACLVIVAI
IYAMTLSNFRSYNADRKRASPWQWLSILRQANIRPLFLMQLCFFYFYTFLELVFPLYSSL
NISLLASGMTFTINAITVILSNLFIIRRVKTASIELSYGFLVFSVAFILIAISSLMDFPS
QLFFYAAGIFFFSIAEVFFTVMIDAQAIANVPVNATGTVMGILGLFSMTGVGLGYTLNGI
LFDYFHSRDIVPWFWGLFIAISGLFFVIALTVSRLYKRERGAR