Protein Info for DDA3937_RS08060 in Dickeya dadantii 3937

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 597 PF00005: ABC_tran" amino acids 26 to 184 (159 residues), 98.7 bits, see alignment E=1.4e-31 amino acids 325 to 475 (151 residues), 107.5 bits, see alignment E=2.6e-34 PF08352: oligo_HPY" amino acids 235 to 267 (33 residues), 30.7 bits, see alignment (E = 1e-10) amino acids 527 to 564 (38 residues), 37.7 bits, see alignment 6.8e-13

Best Hits

Swiss-Prot: 60% identical to GSIA_SALTY: Glutathione import ATP-binding protein GsiA (gsiA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 100% identity to ddd:Dda3937_02992)

Predicted SEED Role

"Oligopeptide transport system permease protein OppB (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SJA2 at UniProt or InterPro

Protein Sequence (597 amino acids)

>DDA3937_RS08060 ABC transporter ATP-binding protein (Dickeya dadantii 3937)
MNQPVLRVEQLNTAFRVNGEWLKVVQDLSFEIGERETVALVGESGSGKSVTALSIMRLLG
GPQVQTRGRVLFDGRDLLALPAREMQHIRGNRIGMVFQEPMTSLNPVLKIGTQITEVLRR
HRGMDHAGARAEAARLLERVRIPAARSRLDEYPLSFSGGMRQRVVIAIALACNPRLLIVD
EPTTALDVTIQAQILALIKTLQDEEGMSILFITHDMGVVAEVADRTMVMYHGAGVEMADT
RQLFRAPQHPYSKTLFSAVPRLGEMADTRLPRRFALFGQSAAASEPLADTVTPGEPVLAV
RDLIKRFDVKSGWLRRVTGRVHAVENVSFSLQPGETLSLVGESGCGKSTTGRAILRLLEP
NGGAVSLCGENMLTAGTSALAGLRMRAQMIFQDPYDSLNPRLTVGSAIAEPMISHGLASA
RQAPQKVAQLLEKVGLQADMAARYPHQFSGGQRQRLCIARALALNPQVIIADEALSALDM
TVKAQIVNLLLDLQQQLGLAYLFISHDMAVVERISHRVAVMYQGEIVEIGPRQAVFNDPQ
HPYTRRLLAAVPVPDPEKRVRRSTQVDELHSPLRPADYQPPTRRYQQVGDGHLVLLS