Protein Info for DDA3937_RS07880 in Dickeya dadantii 3937

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 transmembrane" amino acids 20 to 44 (25 residues), see Phobius details amino acids 56 to 75 (20 residues), see Phobius details amino acids 86 to 107 (22 residues), see Phobius details amino acids 114 to 135 (22 residues), see Phobius details amino acids 154 to 172 (19 residues), see Phobius details amino acids 178 to 197 (20 residues), see Phobius details amino acids 232 to 249 (18 residues), see Phobius details amino acids 269 to 293 (25 residues), see Phobius details amino acids 301 to 320 (20 residues), see Phobius details amino acids 327 to 347 (21 residues), see Phobius details amino acids 359 to 380 (22 residues), see Phobius details amino acids 391 to 411 (21 residues), see Phobius details PF01306: LacY_symp" amino acids 14 to 415 (402 residues), 653.1 bits, see alignment E=2.4e-200 TIGR00882: oligosaccharide:H+ symporter" amino acids 16 to 411 (396 residues), 662.9 bits, see alignment E=8.1e-204 PF12832: MFS_1_like" amino acids 20 to 393 (374 residues), 83 bits, see alignment E=3.5e-27 PF07690: MFS_1" amino acids 24 to 327 (304 residues), 76.6 bits, see alignment E=2.7e-25

Best Hits

Swiss-Prot: 77% identical to MELY_ENTCC: Melibiose permease (melY) from Enterobacter cloacae subsp. cloacae (strain ATCC 13047 / DSM 30054 / NBRC 13535 / NCDC 279-56)

KEGG orthology group: K02532, MFS transporter, OHS family, lactose permease (inferred from 100% identity to ddd:Dda3937_03028)

MetaCyc: 61% identical to lactose permease (Escherichia coli K-12 substr. MG1655)
RXN-17755; RXN0-7215; RXN0-7217; TRANS-RXN-24; TRANS-RXN-94

Predicted SEED Role

"Lactose permease" in subsystem Fructooligosaccharides(FOS) and Raffinose Utilization or Lactose and Galactose Uptake and Utilization or Lactose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SII5 at UniProt or InterPro

Protein Sequence (426 amino acids)

>DDA3937_RS07880 MFS transporter (Dickeya dadantii 3937)
MDISSATPRTSTHRYNRNFWIFGLFFFLYFFIMATCFPFLPVWLAEVIGLNKTQTGVVFS
AISLFAILFQPLMGVVSDRLGLKKHLLWVIAVLLFLFAPFFLYVFAPLLRVNSLLGAMAG
GVYIGLVFSAGSGAVEAYIERVSRQSGFEYGKARMFGCLGWGLCASTAGILFNVNPALVF
WMGSGAAVILLVLLLIARPEPHPTAQVMDALGANQPQVTLKMATRVFGDRKLWMFVLYVV
GVACVYDVFDQQFANFFKSFFATPQQGNQVFGFATTLGELANAVIMFCSPWIINRIGAKN
TLLVAGTIMTVRIVGSAFATTVVEVVALKMLHALEVPFLLVGAFKYITTTFDTRLSATIY
LIGFQFAKQSAAIFLSAMAGNLYDRIGFQHTYLILGAIALTVTLISAFTLSGSRANAQPV
YRTTLS