Protein Info for DDA3937_RS07825 in Dickeya dadantii 3937

Annotation: [citrate (pro-3S)-lyase] ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 347 TIGR00124: [citrate (pro-3S)-lyase] ligase" amino acids 20 to 343 (324 residues), 403.9 bits, see alignment E=4.9e-125 PF00583: Acetyltransf_1" amino acids 37 to 113 (77 residues), 35.9 bits, see alignment E=1.2e-12 TIGR00125: cytidyltransferase-like domain" amino acids 150 to 208 (59 residues), 42.2 bits, see alignment E=7e-15 PF08218: Citrate_ly_lig" amino acids 150 to 338 (189 residues), 257 bits, see alignment E=1.3e-80 PF01467: CTP_transf_like" amino acids 158 to 241 (84 residues), 22.7 bits, see alignment E=1.5e-08

Best Hits

Swiss-Prot: 48% identical to CITC_ECOLI: [Citrate [pro-3S]-lyase] ligase (citC) from Escherichia coli (strain K12)

KEGG orthology group: K01910, [citrate (pro-3S)-lyase] ligase [EC: 6.2.1.22] (inferred from 100% identity to ddd:Dda3937_04525)

MetaCyc: 47% identical to [citrate [pro-3S]-lyase] ligase (Klebsiella pneumoniae)
[Citrate (pro-3S)-lyase] ligase. [EC: 6.2.1.22]

Predicted SEED Role

"[Citrate [pro-3S]-lyase] ligase (EC 6.2.1.22)" (EC 6.2.1.22)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 6.2.1.22

Use Curated BLAST to search for 6.2.1.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SIH4 at UniProt or InterPro

Protein Sequence (347 amino acids)

>DDA3937_RS07825 [citrate (pro-3S)-lyase] ligase (Dickeya dadantii 3937)
MYADESFTFATLDVRVQPRELAEVSQFLGRCQLGMDRDIEFFVVGRHNGRLVACAGLCAN
TIKCVAVDPDYRDRNLGVKVVNEVVQFAAERGQFHLFLYTRPCNIPVFRGCGFYPLACYD
DQAVLMENTPIGIKQYCQSLAAQVKPGRDIGAIVMNANPFTLGHRYLAEQAARACDWLHI
FVVREDVSFFPFTERLEMVRQGVAHIPNLTVHAGSEYMISKATFPGYFLKEEKLITQAHA
ALDLIIFRRYIAPALGITRRFVGTEPFCPVTHQYNQDMHHWLEQAGQVAAPALEVVEIER
TREHSGLAISASEVRRLLKLRQFEPIREIVPATTFAHLQRYGELACA