Protein Info for DDA3937_RS07780 in Dickeya dadantii 3937

Annotation: N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13302: Acetyltransf_3
  • amino acids 2 to 137 (136 residues), 53.3 bits, E=1.5e-17
• PF13420: Acetyltransf_4
  • amino acids 3 to 156 (154 residues), 51.2 bits, E=4.4e-17
• PF00583: Acetyltransf_1
  • amino acids 17 to 137 (121 residues), 72.4 bits, E=1.2e-23
• PF13508: Acetyltransf_7
  • amino acids 53 to 137 (85 residues), 44.2 bits, E=6.1e-15
• PF13673: Acetyltransf_10
  • amino acids 54 to 142 (89 residues), 33.8 bits, E=9.2e-12
• PF08445: FR47
  • amino acids 85 to 138 (54 residues), 34 bits, E=7.3e-12

Best Hits

Swiss-Prot: 61% identical to MNAT_ECOLI: L-amino acid N-acyltransferase MnaT (mnaT) from Escherichia coli (strain K12)

KEGG orthology group: K03823, phosphinothricin acetyltransferase [EC: 2.3.1.183] (inferred from 100% identity to ddd:Dda3937_02841)

MetaCyc: 61% identical to L-amino acid N-acyltransferase (Escherichia coli K-12 substr. MG1655)
Amino-acid N-acetyltransferase. [EC: 2.3.1.1]

Predicted SEED Role

No annotation

MetaCyc Pathways

• L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
• L-arginine biosynthesis II (acetyl cycle) (9/10 steps found)
• superpathway of arginine and polyamine biosynthesis (14/17 steps found)
• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (8/9 steps found)
• L-ornithine biosynthesis I (5/5 steps found)
• phosalacine biosynthesis (2/25 steps found)
• phosphinothricin tripeptide biosynthesis (2/25 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Urea cycle and metabolism of amino groups

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.1, 2.3.1.183

Use Curated BLAST to search for 2.3.1.1 or 2.3.1.183

Sequence Analysis Tools

See E0SIG3 at UniProt or InterPro

Protein Sequence (170 amino acids)

>DDA3937_RS07780 N-acetyltransferase (Dickeya dadantii 3937)
MIIRDAKSDDLETVADIYNHAVLNTTAIFNDTTVDVANRAIWLADRTRLGYPVLVALSDD
GSVMGYASFGDWRAFDGYRHTVEHSVYVHIDHRGKGIAEALMKALIERARAIGKHSMVAG
IESKNAASIRLHEKLGFGRVDPIPQVGMKFGQWLDLTFMFLILDDRPTPN