Protein Info for DDA3937_RS07760 in Dickeya dadantii 3937

Annotation: iron ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 transmembrane" amino acids 27 to 48 (22 residues), see Phobius details amino acids 81 to 100 (20 residues), see Phobius details amino acids 111 to 131 (21 residues), see Phobius details amino acids 137 to 157 (21 residues), see Phobius details amino acids 167 to 188 (22 residues), see Phobius details amino acids 194 to 209 (16 residues), see Phobius details amino acids 216 to 234 (19 residues), see Phobius details amino acids 255 to 283 (29 residues), see Phobius details amino acids 291 to 314 (24 residues), see Phobius details amino acids 325 to 345 (21 residues), see Phobius details PF01032: FecCD" amino acids 36 to 346 (311 residues), 279.9 bits, see alignment E=1.2e-87

Best Hits

Swiss-Prot: 100% identical to CBRC_DICD3: Achromobactin transport system permease protein CbrC (cbrC) from Dickeya dadantii (strain 3937)

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 100% identity to ddd:Dda3937_02846)

Predicted SEED Role

"Siderophore achromobactin ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q47086 at UniProt or InterPro

Protein Sequence (349 amino acids)

>DDA3937_RS07760 iron ABC transporter permease (Dickeya dadantii 3937)
MDKRGGMDHVLVWRQGRFSRQINLTTVGRVSLALLLVLAVMVASLGVGKLMLSPWEVLRA
LWSSQPEGAALIVQQLRLPRVVLAALVGGALAVSGLILQAMIRNPLASPDILGITSGASA
AAVFYLSFLAATLGAHYLPLAAMIGAATAALAVYWLAWQAGVSPQRLVLTGVGVSALLMA
ATTFMLVFSPLTTTLSAYVWLTGSVYGASWRETRELGGWLLLIAPWLVLLARQVRVQQLD
DGLAQGIGVRVQWLRVALLLLSVALAGAAIAWGGAMAFVGLIAPHIAKRLVAPGFAGQAA
MAFLSGAGLVMVADLCGRTLFLPLDLPAGIFVSALGAPFFLYLLIKQRH