Protein Info for DDA3937_RS07750 in Dickeya dadantii 3937

Annotation: iron-siderophore ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF01497: Peripla_BP_2" amino acids 38 to 273 (236 residues), 73.9 bits, see alignment E=6.9e-25

Best Hits

Swiss-Prot: 100% identical to CBRA_DICD3: Achromobactin-binding periplasmic protein (cbrA) from Dickeya dadantii (strain 3937)

KEGG orthology group: K02016, iron complex transport system substrate-binding protein (inferred from 100% identity to ddd:Dda3937_02848)

Predicted SEED Role

"Siderophore achromobactin ABC transporter, substrate-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q47084 at UniProt or InterPro

Protein Sequence (305 amino acids)

>DDA3937_RS07750 iron-siderophore ABC transporter substrate-binding protein (Dickeya dadantii 3937)
MNEYLVSRRRLLRLSLSLLPLGLGRPALAQSLFMPQRVITLFQGATDTAVALGITPAGVV
DSWSEKPMYRYLRQALAGVPHVGLETQPSLEDIVLLKPDAIVASRFRHQRLEPLLSQIAP
VVMLDEIYQFKKTVQVMGQALQRQAVADQLLQNWQLRVNGLREQLQRKFGGDWPPTVSIL
DIREDHIRSYLPGSFPGSVLSELGFGWSDASRAQPGVSLKLTNKESIPVVDADIFFIFLR
SESPSVQRNYESLIRHPLWQQLRAPRRNQVWVVNGVTWSLSGGILGANMMLDDIARVTGI
AGGVS