Protein Info for DDA3937_RS07460 in Dickeya dadantii 3937

Annotation: hydrogenase 4 subunit D

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 479 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 30 to 50 (21 residues), see Phobius details amino acids 77 to 102 (26 residues), see Phobius details amino acids 114 to 132 (19 residues), see Phobius details amino acids 138 to 156 (19 residues), see Phobius details amino acids 168 to 188 (21 residues), see Phobius details amino acids 207 to 230 (24 residues), see Phobius details amino acids 242 to 262 (21 residues), see Phobius details amino acids 268 to 290 (23 residues), see Phobius details amino acids 299 to 321 (23 residues), see Phobius details amino acids 337 to 358 (22 residues), see Phobius details amino acids 371 to 389 (19 residues), see Phobius details amino acids 409 to 434 (26 residues), see Phobius details amino acids 455 to 478 (24 residues), see Phobius details PF00361: Proton_antipo_M" amino acids 136 to 413 (278 residues), 204.4 bits, see alignment E=2.4e-64

Best Hits

Swiss-Prot: 70% identical to HYFD_ECOLI: Hydrogenase-4 component D (hyfD) from Escherichia coli (strain K12)

KEGG orthology group: K12139, hydrogenase-4 component D [EC: 1.-.-.-] (inferred from 100% identity to ddd:Dda3937_00730)

Predicted SEED Role

"Hydrogenase-4 component D"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SHL0 at UniProt or InterPro

Protein Sequence (479 amino acids)

>DDA3937_RS07460 hydrogenase 4 subunit D (Dickeya dadantii 3937)
MENIALATLLLPFLGALWIAFAPQPLAKGLCTLFALLATLGMALLAWRYLDGGKTDQVVT
LYRYGQADLFGFLFDRISLLIGFAVVSLGFLVSLYSCGYLTLGNREHPHDGSNRYYAFLL
VFIGAMAGLTLSSTILGQLLFFEITGGCSWALIGYYQKPKSLRSALKALLVTHIASVGLY
LAAAWLFATTGTFALSAIAQLDDSSKIIVFGGILFAAWGKSAQLPLHVWLPDAMEAPTPV
SAYLHAASMVKVGVYIFARAILSAVEVPHIIGVVGVIMATITLVYGFLMYLPQKDMKRLL
AYSTITQLAYIFLALSLSIFGSRMAFDAGMAYIFNHAYAKSLFFLVAGALSYSCGTRMLP
QLRGMMKRLPLLGVGFCVAALAITGVPPFNGFFSKFPLFAAGFALSRDVWWLLPLLIIAL
VESVASFAWFLYWFGRTVPGEPSEEVASATAVPASMNLVLLVLIVMSLCSSVIAALWLK