Protein Info for DDA3937_RS07440 in Dickeya dadantii 3937

Annotation: hydrogenase 4 subunit H

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF12797: Fer4_2
  • amino acids 32 to 52 (21 residues), 25.1 bits, see alignment (E = 4.7e-09)
• PF12837: Fer4_6
  • amino acids 32 to 55 (24 residues), 30.1 bits, see alignment (E = 1.3e-10)
• PF13237: Fer4_10
  • amino acids 33 to 86 (54 residues), 33.7 bits, E=1.1e-11
• PF00037: Fer4
  • amino acids 34 to 56 (23 residues), 27.8 bits, see alignment (E = 6.7e-10)
  • amino acids 73 to 90 (18 residues), 32.2 bits, see alignment (E = 2.6e-11)
• PF14697: Fer4_21
  • amino acids 36 to 90 (55 residues), 35.1 bits, E=4.6e-12
• PF13187: Fer4_9
  • amino acids 39 to 90 (52 residues), 38.7 bits, E=3.3e-13
• PF12838: Fer4_7
  • amino acids 39 to 89 (51 residues), 50.6 bits, E=8.7e-17

Best Hits

Swiss-Prot: 54% identical to HYCF_ECOLI: Formate hydrogenlyase subunit 6 (hycF) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to ddd:Dda3937_00734)

MetaCyc: 54% identical to hydrogenase 3 iron-sulfur protein HycF (Escherichia coli K-12 substr. MG1655)
Ferredoxin hydrogenase. [EC: 1.12.7.2]

Predicted SEED Role

No annotation

MetaCyc Pathways

• superpathway of fermentation (Chlamydomonas reinhardtii) (8/9 steps found)
• hydrogen production III (1/1 steps found)
• hydrogen production VIII (1/1 steps found)
• hydrogen production VI (1/2 steps found)
• superpathway of hydrogen production (1/2 steps found)
• superpathway of photosynthetic hydrogen production (2/6 steps found)
• L-glutamate degradation VII (to butanoate) (5/12 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism
• Methane metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.12.7.2

Sequence Analysis Tools

See E0SHK6 at UniProt or InterPro

Protein Sequence (189 amino acids)

>DDA3937_RS07440 hydrogenase 4 subunit H (Dickeya dadantii 3937)
MIKLFKTILKAGNSTVKYPFAPLAVPAGFRGKPEYDPAQCIGCAACTMACPANALTMAND
LDNGTRTWQLFLGRCIFCGRCEEVCPTRAIVLSQEFEMAVASKADLYQRATFQLLNCHVC
QRPFAPQKEVEYAMALLAHAGVPESEVEARRHQFETCPDCKRKQNMNHQGNVQLSQHLPA
PTTHKGNAQ