Protein Info for DDA3937_RS07410 in Dickeya dadantii 3937

Annotation: 4Fe-4S dicluster domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 180 PF12800: Fer4_4" amino acids 11 to 22 (12 residues), 10.8 bits, see alignment (E = 0.00029) amino acids 86 to 101 (16 residues), 24.4 bits, see alignment (E = 1.2e-08) PF13247: Fer4_11" amino acids 55 to 153 (99 residues), 37.6 bits, see alignment E=1e-12 PF12838: Fer4_7" amino acids 56 to 102 (47 residues), 28.1 bits, see alignment E=1.2e-09 amino acids 87 to 150 (64 residues), 27.5 bits, see alignment E=1.7e-09 PF12797: Fer4_2" amino acids 80 to 100 (21 residues), 28.1 bits, see alignment (E = 6.6e-10) PF12837: Fer4_6" amino acids 81 to 102 (22 residues), 32.7 bits, see alignment (E = 2.5e-11) PF00037: Fer4" amino acids 82 to 103 (22 residues), 32.7 bits, see alignment (E = 2.2e-11) PF13187: Fer4_9" amino acids 87 to 150 (64 residues), 28.3 bits, see alignment E=7.4e-10 PF12798: Fer4_3" amino acids 88 to 102 (15 residues), 17.6 bits, see alignment (E = 2.7e-06)

Best Hits

Swiss-Prot: 57% identical to HYDN_ECO57: Electron transport protein HydN (hydN) from Escherichia coli O157:H7

KEGG orthology group: K05796, electron transport protein HydN (inferred from 100% identity to ddd:Dda3937_00741)

Predicted SEED Role

"Hydrogenase-4 component A"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SHJ9 at UniProt or InterPro

Protein Sequence (180 amino acids)

>DDA3937_RS07410 4Fe-4S dicluster domain-containing protein (Dickeya dadantii 3937)
MNRFVLADPRKCIGCRTCEVACVLAHSDGNPSSLSPEHFTPRLKVVKGLNVSTTIQCRHC
EDAPCANVCPNGAIVHAGDHIRVQQEKCIGCKTCVVACPYGAMTVISKPVARISHYQTLG
NCIKAEAHKCDLCEGRANGPACVEVCPTKALRLISREDIQEMIQRKQRRAALDEAAEMKF