Protein Info for DDA3937_RS07225 in Dickeya dadantii 3937

Annotation: CidB/LrgB family autolysis modulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 231 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 31 to 52 (22 residues), see Phobius details amino acids 59 to 78 (20 residues), see Phobius details amino acids 90 to 111 (22 residues), see Phobius details amino acids 132 to 163 (32 residues), see Phobius details amino acids 205 to 229 (25 residues), see Phobius details TIGR00659: TIGR00659 family protein" amino acids 5 to 226 (222 residues), 329.1 bits, see alignment E=6.6e-103 PF04172: LrgB" amino acids 12 to 224 (213 residues), 267.7 bits, see alignment E=3.2e-84

Best Hits

Swiss-Prot: 80% identical to YOHK_ECOLI: Inner membrane protein YohK (yohK) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to ddd:Dda3937_00773)

Predicted SEED Role

"LrgA-associated membrane protein LrgB" in subsystem Murein hydrolase regulation and cell death

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SHG1 at UniProt or InterPro

Protein Sequence (231 amino acids)

>DDA3937_RS07225 CidB/LrgB family autolysis modulator (Dickeya dadantii 3937)
MWHDIVWSLPLTLLVFFLARRLAQRLNSPLLNPLLVSMVVLIAFLLVSHIPYERYFRGSS
VLNSLLQPAVVALAFPLYEQLHQIRMRWKSIISVCFLGSVVAMVTGTWIALRLGATPAIA
ASILPKSVTTPIAMAVGGSIGGIPAISAVCVIFVGILGAVFGHTLLNAMRIHTKASRGLA
MGTASHALGTARCAELDYEEGAFSSLALVICGIITSLMAPLLFPLLVALAR