Protein Info for DDA3937_RS07115 in Dickeya dadantii 3937

Annotation: GGDEF domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 519 transmembrane" amino acids 25 to 48 (24 residues), see Phobius details amino acids 302 to 322 (21 residues), see Phobius details PF02743: dCache_1" amino acids 86 to 285 (200 residues), 56.7 bits, see alignment E=2.6e-19 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 349 to 516 (168 residues), 135.4 bits, see alignment E=7.8e-44 PF00990: GGDEF" amino acids 353 to 515 (163 residues), 141 bits, see alignment E=3.1e-45

Best Hits

KEGG orthology group: None (inferred from 100% identity to ddd:Dda3937_00796)

Predicted SEED Role

"Putative Heme-regulated two-component response regulator" in subsystem Putative hemin transporter or cAMP signaling in bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SGP9 at UniProt or InterPro

Protein Sequence (519 amino acids)

>DDA3937_RS07115 GGDEF domain-containing protein (Dickeya dadantii 3937)
MSNNNNSLFSALRFLRSLPFHTSPGITMMAFLAVCSLIFVTTSIWNFLDSYQRMLVDAEK
NVTNLSVAMSRQAEDTFVPIEVAIDDMLRELSQTGMLDSTRVKNVLDTHRAVLPQLVGFY
LFDEKGNLISSTGNGPLYIYNAGRREYFTWLRDNNTTSLFIGKVNVSTITRRRIIPVAKR
INGPNGEFKGVFLATIDHNYFGNFYSYFSLDYDGVLSLMNADGHAIYLYPNREQYINSNF
ADGGLFEKSRLEQGSGNGIWRTTLDNRVRIVGYVKLKRYPLVVAASLDRGALQTRWLTEN
ISAMLLNIMVLFAMFVLGGFVLKQIRLTVKNKEAISRLHQEESDKNKVLQKLALVDPLTK
LANRRRFDLYLDQSLTRAREEGGLLSLIMLDVDFFKRYNDTYGHVLGDRCLTQLGGVLNG
LLLPDGALAARYGGEEFAIILPGMNGEQAAVYGERVVESVRRCAIQHQASLLPRLVVTVS
VGVYSHSSDNPCDIQRLKEGADQALYLAKKKGRDRCVRL