Protein Info for DDA3937_RS07105 in Dickeya dadantii 3937

Annotation: dipeptide epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02746: MR_MLE_N
  • amino acids 2 to 112 (111 residues), 40.8 bits, E=2.4e-14
• PF13378: MR_MLE_C
  • amino acids 134 to 285 (152 residues), 100 bits, E=1.7e-32

Best Hits

Swiss-Prot: 45% identical to AEEP_ECOLI: L-Ala-D/L-Glu epimerase (ycjG) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to ddd:Dda3937_00799)

MetaCyc: 45% identical to L-Ala-D/L-Glu epimerase (Escherichia coli K-12 substr. MG1655)
RXN0-5228 [EC: 5.1.1.20]

Predicted SEED Role

"Muconate cycloisomerase (EC 5.5.1.1)" in subsystem Catechol branch of beta-ketoadipate pathway or Muconate lactonizing enzyme family (EC 5.5.1.1)

MetaCyc Pathways

• muropeptide degradation (4/4 steps found)
• catechol degradation to β-ketoadipate (1/4 steps found)
• catechol degradation III (ortho-cleavage pathway) (1/6 steps found)
• superpathway of salicylate degradation (1/7 steps found)
• aromatic compounds degradation via β-ketoadipate (2/9 steps found)
• mandelate degradation to acetyl-CoA (3/18 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (6/35 steps found)

KEGG Metabolic Maps

• 1,4-Dichlorobenzene degradation
• Benzoate degradation via hydroxylation
• Fluorobenzoate degradation
• Toluene and xylene degradation

Isozymes

Compare fitness of predicted isozymes for: 5.5.1.1

Use Curated BLAST to search for 5.1.1.20 or 5.5.1.1

Sequence Analysis Tools

See E0SGP6 at UniProt or InterPro

Protein Sequence (336 amino acids)

>DDA3937_RS07105 dipeptide epimerase (Dickeya dadantii 3937)
MAELIVTHERWALKETFTVSRGSKTHADVIKVTVRDGRYEGHGESVPYARYDESISGVEA
QLLTLRDAVRRGLDRSTLQTLLPPGAVRNALDCALWDLDSQRQAKPVWQLAGLPRPEPVV
SAFTLSLDTPERMAQAAQRNAHRPLLKLKLADEHDIERVAAVRQWAPQARLIVDANEGWN
VDLYLKLVPALQRLGVSLIEQPLPARDDEALAALPRPIPLCADESCHDRRSLPGLATRYD
MVNIKLDKTGGLTEALLLRQAAQEQGLKIMVGCMVSTSLSMAPATLIAQGAEIVDLDGPL
LLADDRVGGLEWRGSQLYLSEEGLWGHPRPCLTGVA