Protein Info for DDA3937_RS06905 in Dickeya dadantii 3937

Annotation: LuxR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 PF03472: Autoind_bind" amino acids 26 to 177 (152 residues), 80.6 bits, see alignment E=1.3e-26 PF08281: Sigma70_r4_2" amino acids 189 to 236 (48 residues), 31.9 bits, see alignment 1.3e-11 PF00196: GerE" amino acids 193 to 248 (56 residues), 62.5 bits, see alignment E=3.4e-21

Best Hits

KEGG orthology group: K07782, LuxR family transcriptional regulator (inferred from 72% identity to rah:Rahaq_4603)

Predicted SEED Role

"Transcriptional regulator ahyR/asaR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (254 amino acids)

>DDA3937_RS06905 LuxR family transcriptional regulator (Dickeya dadantii 3937)
MRGEPAARLAAHDSDHRGAAAFEPAFEQLYDEVRRLGFDALIYDYTPVPRSLEGELITPS
LLRTRNVPDDMVSLWCQSGYYQVDPVQIHALDSCAPFTWSYCRPENTSLRRVLNEQHRPV
SHYMQNHNMRCGVTVPLHLPKGGFVTVTAIHTGLDTDNEIETVLARIGLLAHTFQEHVFP
LFDEAWYHCRHVHLSPREQECLAWSAEGLTAKEIARKLHRSLATVNLHLNNAARKLGASN
RVQAVVRAMHYRLL