Protein Info for DDA3937_RS06805 in Dickeya dadantii 3937

Annotation: NADP-dependent phosphogluconate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 468 TIGR00873: 6-phosphogluconate dehydrogenase (decarboxylating)" amino acids 5 to 467 (463 residues), 760.5 bits, see alignment E=3.4e-233 PF03446: NAD_binding_2" amino acids 5 to 173 (169 residues), 176.3 bits, see alignment E=4.9e-56 PF00393: 6PGD" amino acids 178 to 466 (289 residues), 448.9 bits, see alignment E=8.2e-139

Best Hits

Swiss-Prot: 90% identical to 6PGD_KLEPN: 6-phosphogluconate dehydrogenase, decarboxylating (gnd) from Klebsiella pneumoniae

KEGG orthology group: K00033, 6-phosphogluconate dehydrogenase [EC: 1.1.1.44] (inferred from 100% identity to ddd:Dda3937_04507)

MetaCyc: 88% identical to 6-phosphogluconate dehydrogenase, decarboxylating (Escherichia coli K-12 substr. MG1655)
Phosphogluconate dehydrogenase (decarboxylating). [EC: 1.1.1.44]

Predicted SEED Role

"6-phosphogluconate dehydrogenase, decarboxylating (EC 1.1.1.44)" in subsystem Pentose phosphate pathway (EC 1.1.1.44)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.44

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SFV4 at UniProt or InterPro

Protein Sequence (468 amino acids)

>DDA3937_RS06805 NADP-dependent phosphogluconate dehydrogenase (Dickeya dadantii 3937)
MSKQQIGVVGMAVMGRNLALNIESRGYTVSVFNRSADKTDEVIAENPGKKLVPCYTVEEF
VESLEKPRRILLMVKAGEATDKTIESLKPYLEKGDILIDGGNTFYKDTIRRNRELSAEGF
NFIGTGVSGGEEGALKGPSIMPGGQKEAYELVAPILEQIAARAEGEPCVTYIGADGAGHY
VKMVHNGIEYGDMQLIAEAYALLKQALGLSNEELASTFSGWNKGELSSYLIEITADIFTK
KDQEGKYLVDVILDEAANKGTGKWTSQSSLDLGEPLSLITESVFARYLSSLKNQRVAASK
VLSGPVAQAFSGDKAEFVEKVRRALYLGKIVSYAQGFSQLKAASDENNWSLNYGEIAKIF
RAGCIIRAQFLQKITDAYAENAAIANLLLAPYFRQIADEYQQALRDVVSYAVQQGIPTPT
FSAAIAYYDSYRSAVLPANLIQAQRDYFGAHTYKRIDKEGVFHTEWLE