Protein Info for DDA3937_RS06785 in Dickeya dadantii 3937

Annotation: NAD-dependent epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF04321: RmlD_sub_bind" amino acids 1 to 234 (234 residues), 50 bits, see alignment E=5.8e-17 PF02719: Polysacc_synt_2" amino acids 4 to 208 (205 residues), 40.1 bits, see alignment E=6.7e-14 PF01370: Epimerase" amino acids 4 to 234 (231 residues), 195.3 bits, see alignment E=2.8e-61 PF16363: GDP_Man_Dehyd" amino acids 4 to 323 (320 residues), 174.7 bits, see alignment E=8.9e-55 PF01073: 3Beta_HSD" amino acids 4 to 281 (278 residues), 60.6 bits, see alignment E=3.3e-20

Best Hits

Swiss-Prot: 65% identical to YCL2_ECO11: Uncharacterized 37.6 kDa protein in cld 5'region from Escherichia coli O111:H-

KEGG orthology group: None (inferred from 100% identity to ddd:Dda3937_04708)

Predicted SEED Role

"dTDP-glucose 4,6-dehydratase (EC 4.2.1.46)" in subsystem Rhamnose containing glycans or dTDP-rhamnose synthesis or linker unit-arabinogalactan synthesis (EC 4.2.1.46)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.46

Use Curated BLAST to search for 4.2.1.46

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SFV0 at UniProt or InterPro

Protein Sequence (335 amino acids)

>DDA3937_RS06785 NAD-dependent epimerase (Dickeya dadantii 3937)
MKFLVTGAAGFIGFYACQSLCAAGHTVVGIDNLNNYYEVSLKEARLAKLRALPGFHFERI
DIADSQAMTALFAAEKFERVIHLAAQAGVRYSLENPMVYAESNLIGHLNVLEGCRHNGVG
HLIYASSSSVYGLNSKTPFATADSTDHPISLYAATKKSNELMAHSYSHLYDLPTTGLRFF
TVYGPWGRPDMALFKFTRRILAGEPIDIYNQGDMWRDFTYVTDIVEGMLRMVDQIPGRDV
GWTVEGGSPATSSAPYQLYNIGHGSPVRLMDFVTALESALGREAVKNFMPMQAGDVYQTY
ADTSDLFAVTGYRPQVGVEKGVQAFVDWYRDFYQA