Protein Info for DDA3937_RS06770 in Dickeya dadantii 3937

Annotation: oligosaccharide flippase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 transmembrane" amino acids 21 to 47 (27 residues), see Phobius details amino acids 50 to 73 (24 residues), see Phobius details amino acids 94 to 120 (27 residues), see Phobius details amino acids 127 to 147 (21 residues), see Phobius details amino acids 155 to 177 (23 residues), see Phobius details amino acids 185 to 204 (20 residues), see Phobius details amino acids 304 to 328 (25 residues), see Phobius details amino acids 340 to 362 (23 residues), see Phobius details amino acids 369 to 389 (21 residues), see Phobius details amino acids 395 to 417 (23 residues), see Phobius details PF01943: Polysacc_synt" amino acids 19 to 286 (268 residues), 157.7 bits, see alignment E=4.3e-50 PF13440: Polysacc_synt_3" amino acids 53 to 334 (282 residues), 37.1 bits, see alignment E=2.3e-13

Best Hits

KEGG orthology group: K03328, polysaccharide transporter, PST family (inferred from 100% identity to ddd:Dda3937_03267)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SFU8 at UniProt or InterPro

Protein Sequence (423 amino acids)

>DDA3937_RS06770 oligosaccharide flippase family protein (Dickeya dadantii 3937)
MNFKFKINSFGGDQLKVILSNIVSLGILQIINYILPILVMPFLVYTIGMGNVGVIAIATA
FCAYFQVFMDYGFSLTATKEIAKNKDDANIVSSIASAVINIKIILFLIFLFLFFLIVYFV
PSYHEHIDIFLFTYMLCFFQSLFPQWYFQAMEKMMYTTIMNSIPKILAVILLFFAIHGPG
DTWKVQFVFFIGNVVSVIWAMFVLKLKFKFSYSLNITMIKEQFIAGWSIFLARFFSTLYK
NSNVIILGTQCNPTLVGSYAVAEKIIRSAQSVQNVIGDSLFPWFVKRSGKNERFFKTIHE
RYKWIIIFIYLFSAAFVALFSDLIARILVHNNWQLVGYQIKIMSLVFFFGGLNYFYGILG
LVAHNFNRLFSSGVMITGLFNVVVCYFLVEIYSVSGASVTMVLSEALLLLLIVSFISKSG
IAK