Protein Info for DDA3937_RS06615 in Dickeya dadantii 3937

Annotation: UDP-glucose 4-epimerase GalE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04321: RmlD_sub_bind
  • amino acids 1 to 162 (162 residues), 47.2 bits, E=6.8e-16
• TIGR01179: UDP-glucose 4-epimerase GalE
  • amino acids 2 to 335 (334 residues), 475.7 bits, E=3e-147
• PF01370: Epimerase
  • amino acids 3 to 262 (260 residues), 195.8 bits, E=3.2e-61
• PF08659: KR
  • amino acids 3 to 137 (135 residues), 28.5 bits, E=5.6e-10
• PF02719: Polysacc_synt_2
  • amino acids 3 to 183 (181 residues), 57.5 bits, E=5.2e-19
• PF16363: GDP_Man_Dehyd
  • amino acids 4 to 324 (321 residues), 194.4 bits, E=1.5e-60
• PF01073: 3Beta_HSD
  • amino acids 4 to 160 (157 residues), 64.9 bits, E=2.5e-21
• PF13460: NAD_binding_10
  • amino acids 7 to 173 (167 residues), 32.2 bits, E=3.9e-11

Best Hits

Swiss-Prot: 79% identical to GALE_YERPE: UDP-glucose 4-epimerase (galE) from Yersinia pestis

KEGG orthology group: K01784, UDP-glucose 4-epimerase [EC: 5.1.3.2] (inferred from 100% identity to ddd:Dda3937_03998)

MetaCyc: 76% identical to UDP-glucose 4-epimerase (Escherichia coli K-12 substr. MG1655)
UDP-glucose 4-epimerase. [EC: 5.1.3.2]

Predicted SEED Role

"UDP-N-acetylglucosamine 4-epimerase (EC 5.1.3.7) / UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem KDO2-Lipid A biosynthesis or Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2, EC 5.1.3.7)

MetaCyc Pathways

• colanic acid building blocks biosynthesis (11/11 steps found)
• stachyose degradation (7/7 steps found)
• D-galactose degradation I (Leloir pathway) (5/5 steps found)
• D-galactose detoxification (3/3 steps found)
• UDP-α-D-galactose biosynthesis (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis I (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis II (5/7 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• UDP-α-D-galactofuranose biosynthesis (1/2 steps found)
• UDP-sugars interconversion (2/9 steps found)
• teichuronic acid biosynthesis (B. subtilis 168) (2/9 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (12/33 steps found)
• mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (1/18 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Galactose metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.2

Use Curated BLAST to search for 5.1.3.2 or 5.1.3.7

Sequence Analysis Tools

See E0SFR3 at UniProt or InterPro

Protein Sequence (338 amino acids)

>DDA3937_RS06615 UDP-glucose 4-epimerase GalE (Dickeya dadantii 3937)
MKVLVTGGIGYIGSHTCVQLIAAGHQPVILDNLCNSKSSVTKAIAHVSGQTPVFYQGDIR
DSGLLQTIFAEHDIGAVIHFAGLKAVGESVREPISYYDNNVYGTLTLVEAMKHAGVKTLI
FSSSATVYGDQPQIPYQESFPTGTPASPYGRSKLMVEQILQDLQRAEPDWSVVLLRYFNP
VGAHPSGEMGEDPQGVPNNLMPYIAQVAVGRRDSLAIFGNDYPTVDGTGVRDYIHVVDLA
DGHIAAMNTLHGKPGVHIYNLGAGVGYSVLQVVEAFSRACGKPLPYHFAPRRDGDLPAYW
ADAEKAARDFNWRVSRTLDEMAADTWRWQSRHPNGFSD