Protein Info for DDA3937_RS06580 in Dickeya dadantii 3937

Annotation: efflux RND transporter periplasmic adaptor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 504 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF19335: HMBD" amino acids 53 to 79 (27 residues), 32.1 bits, see alignment (E = 2.2e-11) PF16576: HlyD_D23" amino acids 113 to 320 (208 residues), 202.3 bits, see alignment E=1.5e-63 PF16572: HlyD_D4" amino acids 161 to 211 (51 residues), 61.4 bits, see alignment 1.4e-20 TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 215 to 395 (181 residues), 132.7 bits, see alignment E=7.2e-43 PF13437: HlyD_3" amino acids 217 to 318 (102 residues), 49.7 bits, see alignment E=1.4e-16 PF11604: CusF_Ec" amino acids 430 to 493 (64 residues), 69.3 bits, see alignment E=5.9e-23

Best Hits

KEGG orthology group: K07798, Cu(I)/Ag(I) efflux system membrane protein CusB (inferred from 100% identity to ddd:Dda3937_03991)

Predicted SEED Role

"Cobalt/zinc/cadmium efflux RND transporter, membrane fusion protein, CzcB family" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SFQ6 at UniProt or InterPro

Protein Sequence (504 amino acids)

>DDA3937_RS06580 efflux RND transporter periplasmic adaptor subunit (Dickeya dadantii 3937)
MNRTFTVSLIAVALAAAAAGYSTGYYSGNRATGTTMPGAAATPDANGGRKVLYWYDPMVP
DKRFDQPGKSPFMDMPLTPRYADEVQDNGGVTVSPRQQQNLGVRTARAERRELRPQATGY
GTVALNERTLRTLVAPSGGVVEQLNISAVQQPVQKGQTLAVLWNPSWAAAQQEYLAVRQL
GDPELSQAARQKLALMFMPESVIRQVERSGKPQPRLTITAPENGYINRLDVRTGAQLTPA
QPLFELASLDPVWVEVEYPAAQAAALHLGDEMLAISDSWPDDTFHGRIAELLPQLDSATR
TLKARVILDNRQQRLKPGMYLTVRLAAGAARQALMIPQQALLVSSRQNRVLLSDGQGYFT
PRPVEVGVIQDGWAEIRSGLNDGDNVVISGQFLIDSEASLRSALTAFSDTAQDKTPPPAT
TPASGYQTKGVIKAINGKQVTLAHDAVPALDWPPMTMDFTFDGAALPANLQPGMTVTFRF
RLDDNGAWLLDIQPVVAAAHGGHL