Protein Info for DDA3937_RS06565 in Dickeya dadantii 3937

Annotation: IS4 family transposase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 PF13006: Nterm_IS4" amino acids 16 to 107 (92 residues), 97.2 bits, see alignment E=5.6e-32 PF01609: DDE_Tnp_1" amino acids 124 to 350 (227 residues), 94.3 bits, see alignment E=8.7e-31

Best Hits

Swiss-Prot: 55% identical to INSG_ECOLI: Transposase InsG for insertion sequence element IS4 (insG) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to ddd:Dda3937_03988)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SFQ3 at UniProt or InterPro

Protein Sequence (440 amino acids)

>DDA3937_RS06565 IS4 family transposase (Dickeya dadantii 3937)
MELSQALGIISVTSPEHACSLSDLIPIELIHQAFTLTDTVTLRKRKLPLESMIWLVVGMS
IFCNRPMTEIVNLMDITDRTGAPFTARSSVIQRRKTLGEDAVRELFDITQRHWNQQAAHP
KWHGLNLFAVDGVVWRTADTPENSTAFSRPAGRNGVGGYPQVRMVCLMELSSHLINASAF
DSENVSEMRLAAQLTEKTPDNSITLFDKGFYSLGLLHHWQTAGENRHWLLPLKKNTQYEV
IRRLGRGDEVVHLKTSPQARKQWPELPAEITARLLTRNVDGKERRVLTSLTDPNRYPGNS
ISELYRHRWEIELGYREAKQEMLDSRWTLRSRLPELVRQELWGVLLTYNLVRYQMVKMAF
ELKGDYLAYQLSFSGTISEITRLLITLPWASPGKMPGELRTLYEKAKWLVLPGRRERSYP
RELRVKAQKYPERKTAGHLK