Protein Info for DDA3937_RS06375 in Dickeya dadantii 3937

Annotation: potassium-transporting ATPase subunit KdpC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 191 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF02669: KdpC" amino acids 5 to 186 (182 residues), 234.8 bits, see alignment E=3.1e-74 TIGR00681: K+-transporting ATPase, C subunit" amino acids 5 to 187 (183 residues), 235.9 bits, see alignment E=1.8e-74

Best Hits

Swiss-Prot: 65% identical to KDPC_PECAS: Potassium-transporting ATPase KdpC subunit (kdpC) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K01548, K+-transporting ATPase ATPase C chain [EC: 3.6.3.12] (inferred from 100% identity to ddd:Dda3937_01551)

MetaCyc: 56% identical to K+ transporting P-type ATPase subunit KdpC (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-2 [EC: 7.2.2.6]

Predicted SEED Role

"Potassium-transporting ATPase C chain (EC 3.6.3.12) (TC 3.A.3.7.1)" in subsystem Potassium homeostasis (EC 3.6.3.12, TC 3.A.3.7.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.12

Use Curated BLAST to search for 3.6.3.12 or 7.2.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SEX7 at UniProt or InterPro

Protein Sequence (191 amino acids)

>DDA3937_RS06375 potassium-transporting ATPase subunit KdpC (Dickeya dadantii 3937)
MNYVRSSLVLLLLMTLITGVGYPLLVTTLGQWLFPTQANGSLLYRQDNVVGSSLIGQAFS
RDGYFQSRPSATSDNAYNAMASGGSNLAVSNPALDKAVSQNVAAWHQRRGDNAPVPVELV
TASASGLDPHISVSAAVYQAGMVANARSLPQDQVEQLINRYTRTPWPAFIGTPVVNVVEL
NMALDQLKPLP