Protein Info for DDA3937_RS06305 in Dickeya dadantii 3937

Annotation: N-acetylglucosamine-6-phosphate deacetylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00221: N-acetylglucosamine-6-phosphate deacetylase
  • amino acids 1 to 376 (376 residues), 506.2 bits, E=2.8e-156
• PF01979: Amidohydro_1
  • amino acids 51 to 379 (329 residues), 140.3 bits, E=9.4e-45
• PF07969: Amidohydro_3
  • amino acids 320 to 367 (48 residues), 31.1 bits, 1.9e-11

Best Hits

Swiss-Prot: 70% identical to NAGA_ECO57: N-acetylglucosamine-6-phosphate deacetylase (nagA) from Escherichia coli O157:H7

KEGG orthology group: K01443, N-acetylglucosamine-6-phosphate deacetylase [EC: 3.5.1.25] (inferred from 100% identity to ddd:Dda3937_03950)

MetaCyc: 70% identical to N-acetylglucosamine-6-phosphate deacetylase (Escherichia coli K-12 substr. MG1655)
N-acetylglucosamine-6-phosphate deacetylase. [EC: 3.5.1.25]

Predicted SEED Role

"N-acetylglucosamine-6-phosphate deacetylase (EC 3.5.1.25)" in subsystem Chitin and N-acetylglucosamine utilization or Sialic Acid Metabolism or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 3.5.1.25)

MetaCyc Pathways

• peptidoglycan recycling I (14/14 steps found)
• superpathway of N-acetylneuraminate degradation (18/22 steps found)
• N-acetylglucosamine degradation II (3/3 steps found)
• N-acetylglucosamine degradation I (2/2 steps found)
• D-galactosamine and N-acetyl-D-galactosamine degradation (2/4 steps found)
• N-acetyl-D-galactosamine degradation (2/5 steps found)
• chitin derivatives degradation (4/8 steps found)
• superpathway of N-acetylglucosamine, N-acetylmannosamine and N-acetylneuraminate degradation (2/6 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Galactose metabolism
• Nucleotide sugars metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.25

Sequence Analysis Tools

See E0SEW2 at UniProt or InterPro

Protein Sequence (383 amino acids)

>DDA3937_RS06305 N-acetylglucosamine-6-phosphate deacetylase (Dickeya dadantii 3937)
MYALTNGRIFTGHQTLDGHAVVVADGLIEAVCPIRELPDNLPRRDLAGALLAPGFIDLQL
NGCGGVQFNDALNNLSVKTLETMQRANEKSGCTSFLPTLITSSDEFMRHSIGVMRAWLAQ
HRHQALGLHLEGPWLNPVKKGTHDAAFIRQPDESLLNYLCDNADVISKITLAPEMVSTAV
IRQLTTAGIVVSAGHSNATWEQAKQGFAAGIRFATHLFNAMPALVGREPGLVGAVYDAPE
VYCGIIADGRHVNWANIRNSKRIKGDKLVLVTDATAPAGSDIDRFTFAGKTIYYRDGICV
DEHGTLSGSALTMIDAVRNCVEHAGIALDEALRMATLYPARAIGEDHRLGSIETGNVANL
TVLTRDFDILNTFVNGEEVFHKQ