Protein Info for DDA3937_RS06185 in Dickeya dadantii 3937

Annotation: nicotinate-nucleotide adenylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00125: cytidyltransferase-like domain
  • amino acids 17 to 79 (63 residues), 37.2 bits, E=2.5e-13
• PF01467: CTP_transf_like
  • amino acids 18 to 198 (181 residues), 102.8 bits, E=8.7e-34
• TIGR00482: nicotinate (nicotinamide) nucleotide adenylyltransferase
  • amino acids 19 to 223 (205 residues), 200.8 bits, E=2.3e-63

Best Hits

Swiss-Prot: 72% identical to NADD_PECAS: Probable nicotinate-nucleotide adenylyltransferase (nadD) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K00969, nicotinate-nucleotide adenylyltransferase [EC: 2.7.7.18] (inferred from 100% identity to ddd:Dda3937_02480)

MetaCyc: 59% identical to nicotinate-nucleotide adenylyltransferase (Escherichia coli K-12 substr. MG1655)
Nicotinate-nucleotide adenylyltransferase. [EC: 2.7.7.18]

Predicted SEED Role

"Nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 2.7.7.18)

MetaCyc Pathways

• aspartate superpathway (24/25 steps found)
• NAD de novo biosynthesis I (5/6 steps found)
• NAD de novo biosynthesis IV (anaerobic) (5/6 steps found)
• NAD salvage pathway II (PNC IV cycle) (4/5 steps found)
• NAD biosynthesis from 2-amino-3-carboxymuconate semialdehyde (3/4 steps found)
• NAD salvage pathway I (PNC VI cycle) (5/7 steps found)
• NAD de novo biosynthesis III (4/6 steps found)
• NAD salvage pathway V (PNC V cycle) (3/5 steps found)
• NAD salvage (plants) (5/11 steps found)
• superpathway of NAD biosynthesis in eukaryotes (7/14 steps found)
• NAD de novo biosynthesis II (from tryptophan) (3/9 steps found)

KEGG Metabolic Maps

• Nicotinate and nicotinamide metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.18

Sequence Analysis Tools

See E0SEU4 at UniProt or InterPro

Protein Sequence (224 amino acids)

>DDA3937_RS06185 nicotinate-nucleotide adenylyltransferase (Dickeya dadantii 3937)
MRYSDLSTPPVTQPLTAYFGGTFDPIHYGHLRPVAALAQDIGLQRVILLPNNVPPHREQP
EASASQRKTMVELAVRDNPLFHIDDRELQRATPSYTIETLEALRAEKGADAPLAFIIGQD
SLLTLHRWHRWQEILDYCHLLVCARPGYHQQLDTAELDAWLTAHQTHDVATLHRRCHGLI
YLAHTPLLPISATDIRHRRQQGLDCHDLLPESVLKYIDTHGLYR