Protein Info for DDA3937_RS06150 in Dickeya dadantii 3937

Annotation: YbeD family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 87 PF04359: DUF493" amino acids 7 to 87 (81 residues), 101.3 bits, see alignment E=1.9e-33

Best Hits

Swiss-Prot: 90% identical to Y1197_SERP5: UPF0250 protein Spro_1197 (Spro_1197) from Serratia proteamaculans (strain 568)

KEGG orthology group: K09158, hypothetical protein (inferred from 100% identity to ddd:Dda3937_02487)

Predicted SEED Role

"Proposed lipoate regulatory protein YbeD" in subsystem Lipoic acid metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SET7 at UniProt or InterPro

Protein Sequence (87 amino acids)

>DDA3937_RS06150 YbeD family protein (Dickeya dadantii 3937)
MKTKLNELLEFPCSFTYKVMGLAKPELVDRVVEVVQRHAPGDYNPQIKPSTKGNYHSVSI
TIIATHIEQVETLYEELGNIDIVRVVL