Protein Info for DDA3937_RS06125 in Dickeya dadantii 3937

Annotation: fluoride efflux transporter CrcB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 127 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 35 to 55 (21 residues), see Phobius details amino acids 67 to 88 (22 residues), see Phobius details amino acids 100 to 124 (25 residues), see Phobius details TIGR00494: protein CrcB" amino acids 6 to 120 (115 residues), 122.9 bits, see alignment E=4.4e-40 PF02537: CRCB" amino acids 6 to 117 (112 residues), 108.5 bits, see alignment E=1e-35

Best Hits

Swiss-Prot: 69% identical to CRCB_PECCP: Putative fluoride ion transporter CrcB (crcB) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K06199, CrcB protein (inferred from 100% identity to ddd:Dda3937_02492)

MetaCyc: 63% identical to F- channel (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-498

Predicted SEED Role

"CrcB protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SET2 at UniProt or InterPro

Protein Sequence (127 amino acids)

>DDA3937_RS06125 fluoride efflux transporter CrcB (Dickeya dadantii 3937)
MYSTLLAVFIGGGIGSVARWQLSVRFNKLFPQIPAGTLLANLIGAFIIGAAMSYFMRQPD
LPPHWKLLLTTGFCGGLTTFSTFSYEMIALLQSGEWAAALFNLLLNLLGSLIMTALAFAL
VGWLSAH