Protein Info for DDA3937_RS05955 in Dickeya dadantii 3937

Annotation: SDR family oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF00106: adh_short" amino acids 3 to 191 (189 residues), 134.6 bits, see alignment E=4.7e-43 PF08659: KR" amino acids 5 to 175 (171 residues), 46.8 bits, see alignment E=4.8e-16 PF13561: adh_short_C2" amino acids 11 to 192 (182 residues), 94.3 bits, see alignment E=1.4e-30

Best Hits

Swiss-Prot: 72% identical to YBBO_ECOLI: Uncharacterized oxidoreductase YbbO (ybbO) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to ddd:Dda3937_01789)

MetaCyc: 72% identical to NADP+-dependent aldehyde reductase YbbO (Escherichia coli K-12 substr. MG1655)
Alcohol dehydrogenase (NADP(+)). [EC: 1.1.1.2]; 1.1.1.- [EC: 1.1.1.2]

Predicted SEED Role

"Putative NAD(P)-dependent oxidoreductase EC-YbbO"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SE06 at UniProt or InterPro

Protein Sequence (258 amino acids)

>DDA3937_RS05955 SDR family oxidoreductase (Dickeya dadantii 3937)
MQKAVLITGCSSGIGLIAAQCLQQRGYRVLAACRRHQDVARMNSLGFEGIDLDLDSSASV
RQAADVVITLTGNRLYGLFNNAGYGLYGPLNTISRQQLEQQFSSNLFGTHQLTQLLLPAM
LPHGEGRIIQTSSVMGLISTPGRGAYAASKYALEAWSDALRMELHGSGLHVSLIEPGPIS
TRFTHNVDQTQQDKPVTNPGIASRFTLPPEAVLPKLIHALESPRPKLRYPVTLLAHGITV
LRRLLPGRVLDHLLRTKS