Protein Info for DDA3937_RS05945 in Dickeya dadantii 3937

Annotation: nicotinamide mononucleotide deamidase-related protein YfaY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 397 TIGR00200: competence/damage-inducible protein CinA N-terminal domain" amino acids 1 to 397 (397 residues), 412.7 bits, see alignment E=1.5e-127 TIGR00177: molybdenum cofactor synthesis domain" amino acids 2 to 167 (166 residues), 103.2 bits, see alignment E=1.2e-33 PF00994: MoCF_biosynth" amino acids 6 to 170 (165 residues), 121 bits, see alignment E=1.7e-39

Best Hits

Swiss-Prot: 63% identical to CINAL_ECO55: CinA-like protein (EC55989_2495) from Escherichia coli (strain 55989 / EAEC)

KEGG orthology group: K03742, competence/damage-inducible protein CinA (inferred from 100% identity to ddd:Dda3937_01787)

Predicted SEED Role

"Molybdopterin binding motif, CinA N-terminal domain / C-terminal domain of CinA type E"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SE04 at UniProt or InterPro

Protein Sequence (397 amino acids)

>DDA3937_RS05945 nicotinamide mononucleotide deamidase-related protein YfaY (Dickeya dadantii 3937)
MLRVEMLCTGDEVLHGQIVDTNAAWLADYLFSQGVPMTSRMTVGDKLEELVAALTERSQI
ADVLIVNGGLGPTSDDLSSLAAATAAGETLVEHAEWIARMEAFFTERGRVMADSNRKQAQ
LPASAELVDNPVGTACGFAMQLNQCLMFFTPGVPSEFKVMVEQQILPRLRQRFAVAEPPL
CLRLTTFGRSESDLASQLDGLPLPPDVVLGYRSSMPIIELKLTGPATRRADMEAVWETVR
DVAGENAIFEGTDGLPAQLARRLGERGLRLTVAEDFTAGLLNWQLREADVPLSGGELRVE
GEALTLAAVAGATQTLAQRHQTELALYVGRSDDGVLTLALHTPEGTFAQTIQVNVRRYSR
KTHQDVVAMLAMNMLRRWLNGWPVYGGHGWISVLETL