Protein Info for DDA3937_RS05880 in Dickeya dadantii 3937

Annotation: bifunctional 2-polyprenyl-6-hydroxyphenol methylase/3-demethylubiquinol 3-O-methyltransferase UbiG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01983: 3-demethylubiquinone-9 3-O-methyltransferase
  • amino acids 14 to 232 (219 residues), 286.3 bits, E=7e-90
• PF02353: CMAS
  • amino acids 42 to 177 (136 residues), 36 bits, E=2.3e-12
• PF01209: Ubie_methyltran
  • amino acids 45 to 155 (111 residues), 35 bits, E=4.4e-12
• PF05175: MTS
  • amino acids 54 to 124 (71 residues), 23.8 bits, E=1.4e-08
• PF13489: Methyltransf_23
  • amino acids 55 to 200 (146 residues), 85 bits, E=2.2e-27
• PF13847: Methyltransf_31
  • amino acids 55 to 162 (108 residues), 62.8 bits, E=1.5e-20
• PF06325: PrmA
  • amino acids 55 to 158 (104 residues), 27.8 bits, E=7.9e-10
• PF13649: Methyltransf_25
  • amino acids 58 to 151 (94 residues), 69.3 bits, E=1.7e-22
• PF08242: Methyltransf_12
  • amino acids 59 to 153 (95 residues), 58.2 bits, E=5.1e-19
• PF08241: Methyltransf_11
  • amino acids 59 to 155 (97 residues), 78.3 bits, E=2.6e-25

Best Hits

Swiss-Prot: 83% identical to UBIG_PECAS: Ubiquinone biosynthesis O-methyltransferase (ubiG) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K00568, 3-demethylubiquinone-9 3-methyltransferase [EC: 2.1.1.- 2.1.1.64] (inferred from 100% identity to ddd:Dda3937_01773)

MetaCyc: 81% identical to bifunctional 3-demethylubiquinone-8 3-O-methyltransferase and 2-octaprenyl-6-hydroxyphenol methylase (Escherichia coli K-12 substr. MG1655)
3-demethylubiquinone-9 3-O-methyltransferase. [EC: 2.1.1.64]; 2-OCTAPRENYL-6-OHPHENOL-METHY-RXN [EC: 2.1.1.64, 2.1.1.222]

Predicted SEED Role

"3-demethylubiquinone-9 3-methyltransferase (EC 2.1.1.64)" in subsystem Ubiquinone Biosynthesis (EC 2.1.1.64)

MetaCyc Pathways

• superpathway of chorismate metabolism (54/59 steps found)
• superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (12/12 steps found)
• ubiquinol-8 biosynthesis (early decarboxylation) (8/8 steps found)
• ubiquinol-8 biosynthesis (late decarboxylation) (6/9 steps found)
• ubiquinol-6 biosynthesis (late decarboxylation) (3/8 steps found)
• ubiquinol-6 biosynthesis from 4-aminobenzoate (yeast) (3/9 steps found)
• ubiquinol-10 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-7 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-7 biosynthesis (late decarboxylation) (2/8 steps found)
• ubiquinol-9 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-9 biosynthesis (late decarboxylation) (2/8 steps found)
• superpathway of ubiquinol-6 biosynthesis (late decarboxylation) (4/11 steps found)
• ubiquinol-10 biosynthesis (late decarboxylation) (2/9 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.222 or 2.1.1.64

Sequence Analysis Tools

See E0SDZ0 at UniProt or InterPro

Protein Sequence (239 amino acids)

>DDA3937_RS05880 bifunctional 2-polyprenyl-6-hydroxyphenol methylase/3-demethylubiquinol 3-O-methyltransferase UbiG (Dickeya dadantii 3937)
MKASAPTPNVDHDEIAKFEAVASRWWDLEGEFKPLHRINPLRLNYILERAGGIFGKQVLD
VGCGGGILAESMAREGARVTGLDMGGEPLQVARLHALESGVQVSYVQETVEAHADAHAGA
YDVVTCMEMLEHVPDPRSVVLACARLVKPGGHVFFSTINRNAKAWLMLIVGAEYLTRMVP
RGTHDIKKFIRPAELLDWVDQTPLRERHMIGLHYNPLLDSFRLGANVDVNYMIHTSHLG