Protein Info for DDA3937_RS05880 in Dickeya dadantii 3937

Annotation: bifunctional 2-polyprenyl-6-hydroxyphenol methylase/3-demethylubiquinol 3-O-methyltransferase UbiG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 TIGR01983: 3-demethylubiquinone-9 3-O-methyltransferase" amino acids 14 to 232 (219 residues), 286.3 bits, see alignment E=7e-90 PF02353: CMAS" amino acids 42 to 177 (136 residues), 36 bits, see alignment E=2.3e-12 PF01209: Ubie_methyltran" amino acids 45 to 155 (111 residues), 35 bits, see alignment E=4.4e-12 PF05175: MTS" amino acids 54 to 124 (71 residues), 23.8 bits, see alignment E=1.4e-08 PF13489: Methyltransf_23" amino acids 55 to 200 (146 residues), 85 bits, see alignment E=2.2e-27 PF13847: Methyltransf_31" amino acids 55 to 162 (108 residues), 62.8 bits, see alignment E=1.5e-20 PF06325: PrmA" amino acids 55 to 158 (104 residues), 27.8 bits, see alignment E=7.9e-10 PF13649: Methyltransf_25" amino acids 58 to 151 (94 residues), 69.3 bits, see alignment E=1.7e-22 PF08242: Methyltransf_12" amino acids 59 to 153 (95 residues), 58.2 bits, see alignment E=5.1e-19 PF08241: Methyltransf_11" amino acids 59 to 155 (97 residues), 78.3 bits, see alignment E=2.6e-25

Best Hits

Swiss-Prot: 83% identical to UBIG_PECAS: Ubiquinone biosynthesis O-methyltransferase (ubiG) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K00568, 3-demethylubiquinone-9 3-methyltransferase [EC: 2.1.1.- 2.1.1.64] (inferred from 100% identity to ddd:Dda3937_01773)

MetaCyc: 81% identical to bifunctional 3-demethylubiquinone-8 3-O-methyltransferase and 2-octaprenyl-6-hydroxyphenol methylase (Escherichia coli K-12 substr. MG1655)
3-demethylubiquinone-9 3-O-methyltransferase. [EC: 2.1.1.64]; 2-OCTAPRENYL-6-OHPHENOL-METHY-RXN [EC: 2.1.1.64, 2.1.1.222]

Predicted SEED Role

"3-demethylubiquinone-9 3-methyltransferase (EC 2.1.1.64)" in subsystem Ubiquinone Biosynthesis (EC 2.1.1.64)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.222 or 2.1.1.64

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SDZ0 at UniProt or InterPro

Protein Sequence (239 amino acids)

>DDA3937_RS05880 bifunctional 2-polyprenyl-6-hydroxyphenol methylase/3-demethylubiquinol 3-O-methyltransferase UbiG (Dickeya dadantii 3937)
MKASAPTPNVDHDEIAKFEAVASRWWDLEGEFKPLHRINPLRLNYILERAGGIFGKQVLD
VGCGGGILAESMAREGARVTGLDMGGEPLQVARLHALESGVQVSYVQETVEAHADAHAGA
YDVVTCMEMLEHVPDPRSVVLACARLVKPGGHVFFSTINRNAKAWLMLIVGAEYLTRMVP
RGTHDIKKFIRPAELLDWVDQTPLRERHMIGLHYNPLLDSFRLGANVDVNYMIHTSHLG