Protein Info for DDA3937_RS05855 in Dickeya dadantii 3937

Annotation: NfeD family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 149 transmembrane" amino acids 12 to 41 (30 residues), see Phobius details amino acids 53 to 72 (20 residues), see Phobius details PF01957: NfeD" amino acids 59 to 147 (89 residues), 77.9 bits, see alignment E=3.4e-26

Best Hits

Swiss-Prot: 61% identical to YBBJ_ECOLI: Inner membrane protein YbbJ (ybbJ) from Escherichia coli (strain K12)

KEGG orthology group: K07340, hypothetical protein (inferred from 100% identity to ddd:Dda3937_04161)

Predicted SEED Role

"Putative activity regulator of membrane protease YbbK" in subsystem YbbK

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SDY5 at UniProt or InterPro

Protein Sequence (149 amino acids)

>DDA3937_RS05855 NfeD family protein (Dickeya dadantii 3937)
MMALVLENAHWFWLSLGGLLLAAEMLGAGGYLLWSGIAALLTGILAWLLPLDWTWQCIAF
AVLTVAAALLWWQWLRRRIEKQPPPVLNQRGQQLIGLHTTLAEPLVNGFGRVNIGDSSWR
VQAEQDLPAGTVVEIVAVEGITLRVRPRT