Protein Info for DDA3937_RS05830 in Dickeya dadantii 3937

Annotation: glycoside hydrolase family 28 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 457 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF00295: Glyco_hydro_28" amino acids 61 to 338 (278 residues), 177.3 bits, see alignment E=6.6e-56 PF13229: Beta_helix" amino acids 171 to 304 (134 residues), 28.9 bits, see alignment E=1.2e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to ddd:Dda3937_04155)

Predicted SEED Role

"Polygalacturonase (EC 3.2.1.15)" in subsystem D-Galacturonate and D-Glucuronate Utilization (EC 3.2.1.15)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.15

Use Curated BLAST to search for 3.2.1.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SDX9 at UniProt or InterPro

Protein Sequence (457 amino acids)

>DDA3937_RS05830 glycoside hydrolase family 28 protein (Dickeya dadantii 3937)
MHKGVAFSLLASCALASVAAQAAEKVAFPDRVCNVTRYGAEGHRLQIALNTESFQKAIDE
CAAAGGGTVLVPAGNYLVEPLFLKSNVRLHLEKNATLVASTGENAYRATDSTRYAEAENG
WLPFISIADAQNVAITGEGTIDGQGAVWWERWRAAIRATGKKGGTDRPRLIYVTRSNRVL
IDGVTLTNSPSFHVVMRYAHDVTVNGTHIIAPWHAPNTDAIDPIDSQNIRITNNVIDCND
DHIAIKAEKPDSRFPNGVVDNIYIANNVLKQGRGISIGSETSGGVNNVLVENNRFEGSMY
GIRIKSLRGKGGEVKNVTYRHTRMLDVEVPLVFSGYYQAAPIVQAEVDKLLQAGGFTLGE
QIYPPDTEPAQPFDKVKTPHFSQVTIVDLESTGRSKAAGYIIGVPEAPLSGFHFEQVRID
AEKGLRVRNAELAAKGLTLNVKQGDALLLDKGANVTR