Protein Info for DDA3937_RS05740 in Dickeya dadantii 3937

Annotation: efflux RND transporter periplasmic adaptor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF00529: CusB_dom_1" amino acids 40 to 362 (323 residues), 53.6 bits, see alignment E=3.4e-18 TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 42 to 377 (336 residues), 293.9 bits, see alignment E=6.4e-92 PF16576: HlyD_D23" amino acids 66 to 295 (230 residues), 50.6 bits, see alignment E=3.2e-17 PF13533: Biotin_lipoyl_2" amino acids 69 to 114 (46 residues), 25.8 bits, see alignment 1.4e-09 PF13437: HlyD_3" amino acids 178 to 292 (115 residues), 28.8 bits, see alignment E=3.6e-10

Best Hits

Swiss-Prot: 69% identical to ACRA_ECOLI: Multidrug efflux pump subunit AcrA (acrA) from Escherichia coli (strain K12)

KEGG orthology group: K03585, membrane fusion protein (inferred from 100% identity to ddd:Dda3937_03299)

MetaCyc: 69% identical to multidrug efflux pump membrane fusion lipoprotein AcrA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-1551; TRANS-RXN-1552; TRANS-RXN-354; TRANS-RXN-355; TRANS-RXN-356; TRANS-RXN-357; TRANS-RXN-359; TRANS-RXN-360; TRANS-RXN0-592

Predicted SEED Role

"RND efflux system, membrane fusion protein CmeA" in subsystem Multidrug Resistance Efflux Pumps or Multidrug efflux pump in Campylobacter jejuni (CmeABC operon)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SD92 at UniProt or InterPro

Protein Sequence (401 amino acids)

>DDA3937_RS05740 efflux RND transporter periplasmic adaptor subunit (Dickeya dadantii 3937)
MNKNRRLTPLAAMLIFSGGLVLTGCDNNASQEGAHQGGAPEVGIVTIKSQTLNIITELPG
RTSAYRIAEVRPQVNGIILKRNFVEGSDVKAGTSLYQIDPATYQAQYNNAKAALVQAQAN
AEIARLTVNRYKPLLGTNYVSKQDYDQAVATARQTEASVAAAKATLDNAQISLNYTRVTA
PITGRVGKSTVTEGALVSNAQTTALTTIQQLDPIYVDVTQSTNDFLRLKKELENGTLQQT
NGKANVQLTLDNGTRYNQPGTLEFSDVTVDETTGSITLRAVFPNPDHNLLPGMFVRAQLD
SGVTPNAILVPQQGVSRTPRGDATVMLVGEGDKVEVHSITTGKAIGDKWLVTSGVKPGDR
IILTGLQKIRPGMQVKAQEVAAGNAQQQQQQQQPQSQPAKS