Protein Info for DDA3937_RS05685 in Dickeya dadantii 3937

Annotation: SmdA family multidrug ABC transporter permease/ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 588 transmembrane" amino acids 18 to 37 (20 residues), see Phobius details amino acids 56 to 76 (21 residues), see Phobius details amino acids 127 to 151 (25 residues), see Phobius details amino acids 157 to 175 (19 residues), see Phobius details amino acids 247 to 268 (22 residues), see Phobius details amino acids 280 to 301 (22 residues), see Phobius details PF00664: ABC_membrane" amino acids 21 to 291 (271 residues), 141.3 bits, see alignment E=4.9e-45 PF00005: ABC_tran" amino acids 352 to 500 (149 residues), 103.8 bits, see alignment E=1.3e-33

Best Hits

Swiss-Prot: 74% identical to MDLA_ECOLI: Multidrug resistance-like ATP-binding protein MdlA (mdlA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to ddd:Dda3937_03311)

Predicted SEED Role

"ATP-binding component of a transport system"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SD79 at UniProt or InterPro

Protein Sequence (588 amino acids)

>DDA3937_RS05685 SmdA family multidrug ABC transporter permease/ATP-binding protein (Dickeya dadantii 3937)
MRLFVQLGWYFRREWKRYLGAVILLIVIAILQLLPPRLVGIIVDGVTQRQMATTTVLWWI
GGILLVALLTYLLRYFWRIWLFGAAYQLAVELREDFYRQLSRQHPAFYLRHRTGDLIARA
TNDVDRVVFAAGEGVLTLVDSLVMGCAVLVVMCTQLSWQLTLMALAPMPLMAVIIKRYGT
QLHQRFKDAQAAFSSLNDHAQESLTSIRMIKAFGLEDHQSGSFARVAADAGRKNMRVARV
DARFDPTIYIAVAFSNLLAVGGGSWMVINGSMTLGALTSFVMYLGLMIWPMLAMAWMFNI
VERGSAAYSRIRQLLSEAPVVVDGSQPLPAESGTLAAEIAAFHYPGHPASVLNDVRFTLE
PGKTLGLCGPTGSGKSTLLALLLRYFDVEQGRITYHQQPLHQIRLDELRSRFAVVGQTPF
LFSDSVANNIALGRPDASQQQIEEAARLANVHDDILRLPQGYQTEVGERGVMLSGGQKQR
IAIARALLLEAEVLVLDDALSAVDGRTEHQILSNLRQWGQKRTLIISSHRLSALVDADEI
LVLQQGYVAQRGAHGQLSQQAGWYRDMYRYQQLEAALDDSPHEERPNE