Protein Info for DDA3937_RS05660 in Dickeya dadantii 3937

Annotation: peptidylprolyl isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 626 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details PF13624: SurA_N_3" amino acids 1 to 165 (165 residues), 161.7 bits, see alignment E=4.2e-51 PF13623: SurA_N_2" amino acids 2 to 140 (139 residues), 107 bits, see alignment E=2.4e-34 PF09312: SurA_N" amino acids 81 to 165 (85 residues), 33.7 bits, see alignment E=1.1e-11 PF13616: Rotamase_3" amino acids 231 to 357 (127 residues), 59.3 bits, see alignment E=1.6e-19 PF13145: Rotamase_2" amino acids 249 to 370 (122 residues), 79.7 bits, see alignment E=9.4e-26 amino acids 395 to 486 (92 residues), 29.6 bits, see alignment E=3.2e-10 PF00639: Rotamase" amino acids 279 to 357 (79 residues), 55.1 bits, see alignment E=3.9e-18

Best Hits

Swiss-Prot: 58% identical to PPID_ECOL6: Peptidyl-prolyl cis-trans isomerase D (ppiD) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K03770, peptidyl-prolyl cis-trans isomerase D [EC: 5.2.1.8] (inferred from 100% identity to ddd:Dda3937_03316)

Predicted SEED Role

"Peptidyl-prolyl cis-trans isomerase PpiD (EC 5.2.1.8)" (EC 5.2.1.8)

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SD74 at UniProt or InterPro

Protein Sequence (626 amino acids)

>DDA3937_RS05660 peptidylprolyl isomerase (Dickeya dadantii 3937)
MMDNLRAAANNVVLKIILALIIGSFVLTGVGDYLIRGSGDYAAKVNGQEITRAQLEQGVQ
NERSRQQEMLGENFSALAANEGYMQQLRKQVLSQLIDETLVVQYAHTLGLNISDEQVKQA
IFSVPEFQTNNRFDNDKYLAQVRQLGLTPDAYAQFLRKQLLTQQLIRGLGNTDFVLQQEL
DNLVAMASQDRTIRTATIDLSARARNQTVSDEEVKNFYDQNKNRYLAPEQFKVSYIMLDA
ASIMDKTKVDNADIAAYYEQHKSEFTQPERKKYSVIQLKTEADAKAALEQLKKGADFAAL
AKEKSTDIVSRRNGGDLGWMDDGSTVDEIKQAGLKQKGQLSDVIKSSVGYLIIRLDDIQA
QHVKALDEVRADLAEKVKREKSLDAFYSLQQKISEAASNDNESLASAEKVANIKAVQTDW
FTRDNVPAALNFQPVTQAIFGGSLVGENGTPGNNSDVISVEGDRAFVLRVTEHKPETTQP
LDQVREQVVQTLKRQKAEQQAKVEAEKILADLYQGKTDSMTAASLSFGAAKEMSSTGQTD
VLAETVFAMQQPKKDKPSYAVAQDQAGNVVLIALDAVKPHVLSDDQKKQFGAQLEQSSVG
ALFDTLLTSLRSQAKIKYGSAAQEVQ