Protein Info for DDA3937_RS05445 in Dickeya dadantii 3937

Annotation: branched-chain amino acid transport system II carrier protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 439 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 41 to 63 (23 residues), see Phobius details amino acids 81 to 99 (19 residues), see Phobius details amino acids 120 to 139 (20 residues), see Phobius details amino acids 150 to 171 (22 residues), see Phobius details amino acids 191 to 212 (22 residues), see Phobius details amino acids 225 to 247 (23 residues), see Phobius details amino acids 282 to 306 (25 residues), see Phobius details amino acids 314 to 333 (20 residues), see Phobius details amino acids 339 to 359 (21 residues), see Phobius details amino acids 370 to 389 (20 residues), see Phobius details amino acids 409 to 427 (19 residues), see Phobius details PF05525: Branch_AA_trans" amino acids 7 to 428 (422 residues), 527.1 bits, see alignment E=1.9e-162 TIGR00796: branched-chain amino acid transport system II carrier protein" amino acids 14 to 415 (402 residues), 526 bits, see alignment E=3.5e-162

Best Hits

Swiss-Prot: 75% identical to BRNQ_SALTY: Branched-chain amino acid transport system 2 carrier protein (brnQ) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03311, branched-chain amino acid:cation transporter, LIVCS family (inferred from 100% identity to ddd:Dda3937_01943)

MetaCyc: 76% identical to branched chain amino acid transporter BrnQ (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-126; TRANS-RXN-126A; TRANS-RXN-126B

Predicted SEED Role

"Branched-chain amino acid transport system carrier protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SD30 at UniProt or InterPro

Protein Sequence (439 amino acids)

>DDA3937_RS05445 branched-chain amino acid transport system II carrier protein (Dickeya dadantii 3937)
MSHRLTSKDIVALGFMTFALFVGAGNIIFPPMVGQQAGEHVWIAALGFLITAVGLPVLTV
IALARVGGGIDTLSSPIGKKAGVLLATVCYLAVGPLFATPRTATVSFEVGIAPLVGEGAS
PLLIYSLIYFAIVIAISLYPGRLLDTVGHILAPVKIIALTVLGIAALLWPAGTPMPTAEA
YQQVPFSSGFVNGYLTMDTLGAMVFGIVIVNAARSRGVSDAALLTRYTIWAGLIAGLGLT
LVYLSLFHLGSFSDSLVPNAQNGAEILHAYVQYTFGNMGSSFLALLIFIACMVTAVGLTC
ACAEFFAQYLPLSYRALVFVLGLFSMVVSNLGLSHLIQLSVPVLTAIYPPCIVLVLLSFT
RRWWNNSTHVIAPVMLVSLLFGLIDGIKSSAFQSLLPGWTQSLPMSEQGLAWLPPSLLIL
LVVAIYDRITGRQEVTAHS