Protein Info for DDA3937_RS05340 in Dickeya dadantii 3937

Annotation: N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 176 PF13420: Acetyltransf_4" amino acids 14 to 160 (147 residues), 33.7 bits, see alignment E=8.9e-12 PF00583: Acetyltransf_1" amino acids 32 to 140 (109 residues), 55.9 bits, see alignment E=1.3e-18 PF13302: Acetyltransf_3" amino acids 32 to 140 (109 residues), 37.7 bits, see alignment E=8.3e-13 PF13673: Acetyltransf_10" amino acids 40 to 145 (106 residues), 29.2 bits, see alignment E=2e-10 PF13508: Acetyltransf_7" amino acids 56 to 141 (86 residues), 40.1 bits, see alignment E=9.9e-14

Best Hits

Swiss-Prot: 54% identical to PAT_ALCFA: Phosphinothricin N-acetyltransferase (pat) from Alcaligenes faecalis

KEGG orthology group: K03823, phosphinothricin acetyltransferase [EC: 2.3.1.183] (inferred from 100% identity to ddd:Dda3937_01922)

Predicted SEED Role

"FIG01201438: hypothetical protein"

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.183

Use Curated BLAST to search for 2.3.1.183

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SCH6 at UniProt or InterPro

Protein Sequence (176 amino acids)

>DDA3937_RS05340 N-acetyltransferase (Dickeya dadantii 3937)
MSAIVIEDAGAEHIAAIRDIYAHHVLHSLATFETEPPDEAEMRDRWQKIRDAGLPWLVAT
ENKQVLGYCYLGFYRARYAYRFTLEDSIYLHPDHLGKGVGKRLLSAALLQAEQQGHRQVV
SVVADSGNQASLQLHLSLGFAQVGMLRSVGMKHGRWVDTVLLQRALGEGDASLPPV