Protein Info for DDA3937_RS05295 in Dickeya dadantii 3937

Annotation: L-tyrosine/L-tryptophan isonitrile synthase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 587 PF05141: DIT1_PvcA" amino acids 40 to 297 (258 residues), 216.5 bits, see alignment E=5.3e-68 PF02668: TauD" amino acids 330 to 584 (255 residues), 114.4 bits, see alignment E=8.9e-37

Best Hits

KEGG orthology group: None (inferred from 100% identity to ddd:Dda3937_01912)

Predicted SEED Role

"PvcB protein, related to amino acid oxidizing enzymes"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SCG6 at UniProt or InterPro

Protein Sequence (587 amino acids)

>DDA3937_RS05295 L-tyrosine/L-tryptophan isonitrile synthase family protein (Dickeya dadantii 3937)
MHDNLNETAGKIADIVKSYLVQAQDDRFEPEGRVFLEKQISAFLSAGEPVRFVLPGFPCK
SPNIVDKTFGVLPDYGDVISINRLDSLAKAIQALYEPGCQVTILSDGTTFNDIVEVPDTT
RKEYNQQLRALIQSPYIEWKALGDFLPETRSDDDTRKALIKSAGLPYKGIADFIKRVGNH
DALAATHDKVCSYLYNDVRLNRQPQQSNEDYLNSVAEKAYQMMYRGQALSALVERAFPDA
IRLSVHQYDNNGPKFTFGFADGLATVRQPWHSVPVLSASGNVSLLGHASVDKDHHVLVTY
QGHPWVYVETGDASARKFDYELLKQPLFGLKIDDPQGLGVEALSPAFLAFLSAQFGFVCI
KGVQFERSEQLETFCQPFGEIFQWQFGAVHVVKPEEKPSGFVHSLEKTPIHWDLSMIRLD
HEQVGGNPWFTAERFMLYCKTPPKKGEGSTTVVDGRIVMDMVGPDVVKKWEDVHITYNTP
MTYFGGKPRTYPLVYAHPKTGKKAFRYQEGSDSELQKFTVEVEGVSGQESQAFIEELDRL
VYDERCMIAHDWDQGDLLIIDNWQTLHGRLSMTEASRGRELWRVQVF