Protein Info for DDA3937_RS05150 in Dickeya dadantii 3937

Annotation: sigma E protease regulator RseP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 451 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 56 to 73 (18 residues), see Phobius details amino acids 98 to 122 (25 residues), see Phobius details amino acids 377 to 398 (22 residues), see Phobius details amino acids 427 to 446 (20 residues), see Phobius details TIGR00054: RIP metalloprotease RseP" amino acids 3 to 451 (449 residues), 519.9 bits, see alignment E=2.4e-160 PF02163: Peptidase_M50" amino acids 10 to 439 (430 residues), 264.5 bits, see alignment E=1.3e-82 PF13180: PDZ_2" amino acids 212 to 287 (76 residues), 36.4 bits, see alignment E=1.1e-12 PF00595: PDZ" amino acids 212 to 277 (66 residues), 38.4 bits, see alignment E=2.6e-13 PF17820: PDZ_6" amino acids 227 to 278 (52 residues), 46.9 bits, see alignment 3.8e-16

Best Hits

Swiss-Prot: 78% identical to RSEP_YERPE: Protease RseP (rseP) from Yersinia pestis

KEGG orthology group: K11749, regulator of sigma E protease [EC: 3.4.24.-] (inferred from 100% identity to ddd:Dda3937_04488)

MetaCyc: 73% identical to intramembrane zinc metalloprotease RseP (Escherichia coli K-12 substr. MG1655)
3.4.21.-; RXN-18678

Predicted SEED Role

"Intramembrane protease RasP/YluC, implicated in cell division based on FtsL cleavage"

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SCD6 at UniProt or InterPro

Protein Sequence (451 amino acids)

>DDA3937_RS05150 sigma E protease regulator RseP (Dickeya dadantii 3937)
MLNILWSLAAFIVALGVLITVHEFGHFWVARRCGVRVERFSIGFGKALWRRRDRQGTEYV
IALIPLGGYVKMLDGRVDEVPAGLQHQAFNHKTVWQRAAIVSAGPIANFIFAVIAYWLVF
IIGVPGVRPVVGEVLPGSIAAQAQISPGMELKSIDGIETPDWDSARLALIGKIGEPDVVI
ETAPLGVARTESKRLELQDWHFDPERQDPAVSLGIVPKGPQVEAVLTQVQPRSAAEKAGL
QVGDRIVKVDGQLLARWQQFVIAVRDNPGKPITLEVERGGDSLSVALTPDSKTVGKNRLE
GFAGVVPKVTPLPDEYKTVRQYGPFSAIYEAGNKTWLLMKLTVSMLGKLITGDVKLNNLS
GPISIAQGAGMSADYGLVYYLMFLALISVNLGIINLFPLPVLDGGHLLFLAIEKLKGGPV
SERVQDVSYRIGTVLLMMLMGLALFNDFSRL