Protein Info for DDA3937_RS05130 in Dickeya dadantii 3937

Annotation: ribosome recycling factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 185 TIGR00496: ribosome recycling factor" amino acids 11 to 185 (175 residues), 259.5 bits, see alignment E=6.4e-82 PF01765: RRF" amino acids 20 to 183 (164 residues), 232.9 bits, see alignment E=9.4e-74

Best Hits

Swiss-Prot: 88% identical to RRF_PECCP: Ribosome-recycling factor (frr) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K02838, ribosome recycling factor (inferred from 100% identity to ddd:Dda3937_00882)

Predicted SEED Role

"Ribosome recycling factor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SCD2 at UniProt or InterPro

Protein Sequence (185 amino acids)

>DDA3937_RS05130 ribosome recycling factor (Dickeya dadantii 3937)
MINEIRKDAETRMDKCVEAFKNQISKVRTGRASPSLLDGIHVEYYGSATPLRQLANIVVE
DTRTLAVTVFDRTLGPAVEKAIMASDLGLNPMSAGTVIRVPLPPLTEERRKDLIKVVRGE
AEQSRVAVRNVRRDANDKLKAQLKEKTISEDDERRSQDDVQKLTDSFIKKIDAVLAEKEK
ELMDF