Protein Info for DDA3937_RS04990 in Dickeya dadantii 3937

Annotation: amino-acid N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01890: amino-acid N-acetyltransferase
  • amino acids 8 to 440 (433 residues), 648.6 bits, E=2.3e-199
• PF00696: AA_kinase
  • amino acids 25 to 267 (243 residues), 119.8 bits, E=2.5e-38
• PF00583: Acetyltransf_1
  • amino acids 327 to 412 (86 residues), 41.1 bits, E=2.9e-14
• PF13508: Acetyltransf_7
  • amino acids 335 to 414 (80 residues), 39.7 bits, E=8.1e-14

Best Hits

Swiss-Prot: 91% identical to ARGA_PECCP: Amino-acid acetyltransferase (argA) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K14682, amino-acid N-acetyltransferase [EC: 2.3.1.1] (inferred from 100% identity to ddd:Dda3937_00857)

MetaCyc: 85% identical to N-acetylglutamate synthase (Escherichia coli K-12 substr. MG1655)
Amino-acid N-acetyltransferase. [EC: 2.3.1.1]

Predicted SEED Role

"N-acetylglutamate synthase (EC 2.3.1.1)" in subsystem Arginine Biosynthesis extended (EC 2.3.1.1)

MetaCyc Pathways

• L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
• L-arginine biosynthesis II (acetyl cycle) (9/10 steps found)
• superpathway of arginine and polyamine biosynthesis (14/17 steps found)
• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (8/9 steps found)
• L-ornithine biosynthesis I (5/5 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.1

Sequence Analysis Tools

See E0SBV8 at UniProt or InterPro

Protein Sequence (441 amino acids)

>DDA3937_RS04990 amino-acid N-acetyltransferase (Dickeya dadantii 3937)
MKERSTELVQGFRHSVPYINAHRGKTFVIMLGGEAIEHENFAKIVNDIGLLHSLGIKLVV
VYGARPQIDANLMAHHYEPRYHKHTRVTDSTTLELVKQAAGMLQLDITARLSMSLLNTPL
QGAHINVVSGNFIIAQPLGVDDGVDYCHSGRIRRIDEEALHRQLDSGAIVLLGPVAVSVT
GESFNLTSEEVATQLAIKLRAEKMIGFCASQGVTNIEGSIVSELLPDEAQQRIQSLEEAG
DYNSEIVRFLRGAVKACRSGVRRSHLISYQEDGALLQELFSRDGIGTQIVMESAEQIRRA
TINDIGGILELIRPLEQQGILVRRSREQLEMEIDKFTVVVRDNLTIACAALYPFPEESIG
EMACVAVHPEYRNSSRGDQLLHHIAVQARQQGLKRLFVLTTHSIHWFQERGFQPAEVAVL
PKRKQELYNYQRRSKILVIDL