Protein Info for DDA3937_RS04980 in Dickeya dadantii 3937

Annotation: potassium:proton antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 134 transmembrane" amino acids 20 to 44 (25 residues), see Phobius details PF12528: T2SSppdC" amino acids 44 to 122 (79 residues), 78.2 bits, see alignment E=3.3e-26

Best Hits

KEGG orthology group: K02681, prepilin peptidase dependent protein C (inferred from 100% identity to ddd:Dda3937_00855)

Predicted SEED Role

"FIG004136: Prepilin peptidase dependent protein C precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SBV6 at UniProt or InterPro

Protein Sequence (134 amino acids)

>DDA3937_RS04980 potassium:proton antiporter (Dickeya dadantii 3937)
MRRSWPVSWRNEKPRRDPCAGFSLPETLVAALLFAVSLTGLLQYHQILQQSLLHQMQQRQ
AWRLAHQQLETEGAGSISPPQIVPAGWGVSREEQRYPPACRRVTVTVVTPYRYRAVLGRW
FCDAPDAVVQRDSP