Protein Info for DDA3937_RS04695 in Dickeya dadantii 3937

Annotation: sulfite exporter TauE/SafE family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 242 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 28 to 50 (23 residues), see Phobius details amino acids 68 to 88 (21 residues), see Phobius details amino acids 94 to 113 (20 residues), see Phobius details amino acids 125 to 147 (23 residues), see Phobius details amino acids 150 to 150 (1 residues), see Phobius details amino acids 178 to 206 (29 residues), see Phobius details amino acids 218 to 236 (19 residues), see Phobius details PF01925: TauE" amino acids 6 to 234 (229 residues), 100.7 bits, see alignment E=5.2e-33

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 91% identity to ddc:Dd586_0859)

Predicted SEED Role

"Predicted permeases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (242 amino acids)

>DDA3937_RS04695 sulfite exporter TauE/SafE family protein (Dickeya dadantii 3937)
MSYILILLLGLFAGSVSGIVGTGGSIILLPALAWAFGPQAAVPIMAIAATMSNISKVILW
RNAINLRALGCYCLPGIPASIIGASLLWAMPVRLSSLCIGLFFLLLIPLRHLARQRAFSL
NDSQLAVAGGVVGFLTGVVFSTGPLTLPLFAGYGLLKGALLATESAASLVIYLTKAATFG
VVGALPLSVLCAGLMVGLTQVAGVYIGKRFVLRLSDALFNRLVDGMMLIAGLSLLWETLP
AH