Protein Info for DDA3937_RS04660 in Dickeya dadantii 3937

Annotation: queuosine precursor transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 transmembrane" amino acids 79 to 98 (20 residues), see Phobius details amino acids 105 to 130 (26 residues), see Phobius details amino acids 142 to 163 (22 residues), see Phobius details amino acids 175 to 195 (21 residues), see Phobius details amino acids 216 to 241 (26 residues), see Phobius details amino acids 253 to 273 (21 residues), see Phobius details TIGR00697: conserved hypothetical integral membrane protein" amino acids 79 to 279 (201 residues), 99.3 bits, see alignment E=1.3e-32 PF02592: Vut_1" amino acids 116 to 271 (156 residues), 141.4 bits, see alignment E=1.5e-45

Best Hits

KEGG orthology group: K09125, hypothetical protein (inferred from 100% identity to ddd:Dda3937_01463)

Predicted SEED Role

"Putative preQ0 transporter" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SBN6 at UniProt or InterPro

Protein Sequence (291 amino acids)

>DDA3937_RS04660 queuosine precursor transporter (Dickeya dadantii 3937)
MDANRKFKLLGFNHSGELSANIMVLSTGKMIHMDLKELVDSDISDDLSRHELNALYKKLY
SGKDITTAYDISDRNERSWLAYLIITAALCVIYIFSTVSGVKPIFIPALNLVVPPAVFVY
PLTFILVDILNEFYGLRLARRTILIAFFFHLAFVLGLWVTSLIPGLPEWEYSKTYSGIVE
SMMAVLVASSLAYLISENINAWVLHKIKILTKSRYLFIRVITSTVTASAVDSVIFCTIAF
YNVLSFDVIRTMILSQFLIKVVYAVLGVGPIYGTRRLFRKYIHAIPVPARN