Protein Info for DDA3937_RS04625 in Dickeya dadantii 3937

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 70 to 92 (23 residues), see Phobius details amino acids 104 to 123 (20 residues), see Phobius details amino acids 151 to 177 (27 residues), see Phobius details amino acids 198 to 217 (20 residues), see Phobius details amino acids 255 to 280 (26 residues), see Phobius details PF00528: BPD_transp_1" amino acids 81 to 280 (200 residues), 76.8 bits, see alignment E=9.3e-26

Best Hits

Swiss-Prot: 38% identical to Y4OQ_SINFN: Probable ABC transporter permease protein y4oQ (NGR_a02190) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 100% identity to ddd:Dda3937_01456)

MetaCyc: 34% identical to polyol ABC-type transporter permease component MtlF (Pseudomonas fluorescens)
7.5.2.M2 [EC: 7.5.2.M2]; 7.5.2.M2 [EC: 7.5.2.M2]; 7.5.2.M2 [EC: 7.5.2.M2]

Predicted SEED Role

"Maltose/maltodextrin ABC transporter, permease protein MalF" in subsystem Maltose and Maltodextrin Utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.M2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SB78 at UniProt or InterPro

Protein Sequence (289 amino acids)

>DDA3937_RS04625 sugar ABC transporter permease (Dickeya dadantii 3937)
MHFDSRWQRWLLLMPAATLLLLLTLYPIGQMLLYSFSKVDYAASRSWVGLENYRQLFADW
FFTTSLKNTLLFSFGSSLLQVLLGLALALLLYRHFPGRQWVLSLLIYPMMISTLVCSAIW
RVWFHYDFGLLNNCLTALGLMPQPWLSSPHLALWSLMLVDIWQWTPMACLVILAGLQAIP
KDVLEAAQSDGANGWKRLWYVTLPLIRQPLMLALLLRSIDTFKLFDKVYALTGGGPGYAT
ETLSLYIYQQGFKFFNLGLASAGAVIMLLFAAAMSLVYAWQLLRGGKTA