Protein Info for DDA3937_RS04625 in Dickeya dadantii 3937
Annotation: sugar ABC transporter permease
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 38% identical to Y4OQ_SINFN: Probable ABC transporter permease protein y4oQ (NGR_a02190) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)
KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 100% identity to ddd:Dda3937_01456)MetaCyc: 34% identical to polyol ABC-type transporter permease component MtlF (Pseudomonas fluorescens)
7.5.2.M2 [EC: 7.5.2.M2]; 7.5.2.M2 [EC: 7.5.2.M2]; 7.5.2.M2 [EC: 7.5.2.M2]
Predicted SEED Role
"Maltose/maltodextrin ABC transporter, permease protein MalF" in subsystem Maltose and Maltodextrin Utilization
Isozymes
No predicted isozymesUse Curated BLAST to search for 7.5.2.M2
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See E0SB78 at UniProt or InterPro
Protein Sequence (289 amino acids)
>DDA3937_RS04625 sugar ABC transporter permease (Dickeya dadantii 3937) MHFDSRWQRWLLLMPAATLLLLLTLYPIGQMLLYSFSKVDYAASRSWVGLENYRQLFADW FFTTSLKNTLLFSFGSSLLQVLLGLALALLLYRHFPGRQWVLSLLIYPMMISTLVCSAIW RVWFHYDFGLLNNCLTALGLMPQPWLSSPHLALWSLMLVDIWQWTPMACLVILAGLQAIP KDVLEAAQSDGANGWKRLWYVTLPLIRQPLMLALLLRSIDTFKLFDKVYALTGGGPGYAT ETLSLYIYQQGFKFFNLGLASAGAVIMLLFAAAMSLVYAWQLLRGGKTA