Protein Info for DDA3937_RS04555 in Dickeya dadantii 3937

Annotation: DNA-3-methyladenine glycosylase 2 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 PF00730: HhH-GPD" amino acids 49 to 196 (148 residues), 61 bits, see alignment E=6.5e-21

Best Hits

Swiss-Prot: 50% identical to MAG1_SCHPO: DNA-3-methyladenine glycosylase 1 (mag1) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: K01247, DNA-3-methyladenine glycosylase II [EC: 3.2.2.21] (inferred from 100% identity to ddd:Dda3937_01441)

Predicted SEED Role

"DNA-3-methyladenine glycosylase II (EC 3.2.2.21)" in subsystem DNA Repair Base Excision (EC 3.2.2.21)

Isozymes

Compare fitness of predicted isozymes for: 3.2.2.21

Use Curated BLAST to search for 3.2.2.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SB63 at UniProt or InterPro

Protein Sequence (224 amino acids)

>DDA3937_RS04555 DNA-3-methyladenine glycosylase 2 family protein (Dickeya dadantii 3937)
MTTSPLPFDEPQALAHLAAIDAHWARLIDGVGHIRFESRPAREPYDALIRAVASQQLSNR
AAAAIIGKLQQRFAVGENGFPSADQLATCEPEVLRQCGFSARKIDTVKGIAQGVQNGLVP
SRAEAEHLDDETLIERLCTLKGIGRWTVEMLLISTLERMDIMPVDDLGIKQGFRYLYRLP
QDPTRKAMLEMSEACRPYRTLAAWYLWRIPHMPDYAEYRASLRQ